Teriparatide (DB06285): A Comprehensive Monograph on the First-in-Class Anabolic Agent for Osteoporosis

Executive Summary

Teriparatide represents a landmark achievement in the management of osteoporosis, establishing a new therapeutic class of bone-forming (anabolic) agents. As a recombinant form of the biologically active 1-34 N-terminal fragment of human parathyroid hormone (hPTH), its mechanism of action is fundamentally distinct from the prevalent antiresorptive therapies. Administered via once-daily subcutaneous injection, teriparatide generates a pulsatile hormonal signal that preferentially stimulates osteoblastic bone formation over osteoclastic resorption. This unique "anabolic window" leads to substantial improvements in bone mass, microarchitecture, and strength.

Clinical evidence, anchored by the pivotal Fracture Prevention Trial and numerous subsequent studies, has unequivocally demonstrated its efficacy in significantly reducing the risk of vertebral fractures in high-risk populations, including postmenopausal women, men with primary or hypogonadal osteoporosis, and patients with glucocorticoid-induced osteoporosis. Head-to-head trials have further established its superiority over oral bisphosphonates in increasing bone mineral density (BMD) and reducing vertebral fracture incidence.

The therapeutic journey of teriparatide has been shaped by a decades-long concern regarding a preclinical finding of osteosarcoma in rats. This led to a "black box" warning and a two-year lifetime treatment limit. However, extensive post-marketing surveillance and real-world data from millions of patients have not substantiated this risk in humans, culminating in the removal of the boxed warning by the U.S. Food and Drug Administration (FDA) in 2020. This regulatory evolution has reshaped the risk-benefit assessment, allowing for more flexible use in patients with sustained high fracture risk.

Common adverse effects include arthralgia, nausea, and transient orthostatic hypotension. The primary safety considerations involve managing transient hypercalcemia and cautious use in patients with urolithiasis or those taking digoxin. Following the completion of a teriparatide course, it is standard practice to initiate an antiresorptive agent to preserve the accrued bone mass. With the advent of biosimilars, the accessibility and clinical utility of teriparatide are expected to expand, solidifying its role as a cornerstone therapy for severe osteoporosis.

Teriparatide: A Paradigm Shift in Osteoporosis Therapy

The development and approval of teriparatide marked a fundamental change in the therapeutic approach to osteoporosis, shifting the paradigm from merely slowing bone loss to actively building new, stronger bone. Its history is a compelling narrative of scientific rediscovery, engineering, and sophisticated regulatory evaluation.

Historical Context and Development

The anabolic potential of the parathyroid hormone was first observed in the 1920s, when early studies showed that parathyroid glandular extracts could stimulate bone acquisition in animal models.[1] However, this remarkable finding lay dormant for nearly half a century. The prevailing understanding of parathyroid hormone (PTH) was centered on its role in hyperparathyroidism, a condition characterized by continuous high levels of PTH that leads to bone resorption and skeletal fragility.

Interest was rekindled in the 1970s, largely through the efforts of British pharmacologist Dr. John Parsons and his colleagues, who began to systematically investigate the paradoxical, bone-building effects of PTH.[1] Using contemporary laboratory methods, they demonstrated that intermittent, low-dose administration of the N-terminal fragment of PTH, hPTH(1-34), could dramatically increase bone mass in various mammalian species. Human studies soon followed, confirming a striking increase in trabecular bone mass and improvements in cortical bone, validating the concept of an "anabolic window".[1]

Eli Lilly and Company undertook the formal clinical development of this fragment, now known as teriparatide, culminating in a large-scale registration trial in postmenopausal women with osteoporosis. The program faced a significant crisis when long-term toxicology studies in Fischer 344 rats revealed a dose- and duration-dependent increase in the incidence of osteosarcoma, a malignant bone tumor.[1] This finding led to the abrupt termination of the human Fracture Prevention Trial.[1] The subsequent regulatory review involved an intense and nuanced debate. The ambiguity regarding the relevance of this rat-specific finding to human physiology was weighed against the compelling anti-fracture efficacy observed in the prematurely halted trial. Ultimately, regulatory bodies like the FDA concluded that for patients with severe osteoporosis and a high risk of debilitating fractures, the potential benefits of teriparatide outweighed the theoretical risk, leading to its landmark approval.[1] This decision set a critical precedent for how regulatory agencies manage preclinical safety signals in the context of high unmet medical need and strong clinical benefit.

Classification as a Bone-Forming (Anabolic) Agent

Teriparatide is the first approved drug in the class of bone-forming, or anabolic, agents.[5] This classification distinguishes it fundamentally from the more common antiresorptive therapies, such as bisphosphonates (e.g., alendronate, risedronate), selective estrogen receptor modulators (e.g., raloxifene), and denosumab.

Antiresorptive agents function primarily by inhibiting the activity of osteoclasts, the cells responsible for breaking down bone tissue. By reducing the rate of bone resorption, these drugs slow the pace of bone loss and can lead to modest increases in bone mineral density.[8] In contrast, teriparatide works through a completely different mechanism. It directly stimulates osteoblasts, the cells responsible for synthesizing new bone matrix.[10] This direct stimulation of bone formation leads to increases in bone mass, improvements in skeletal microarchitecture, and enhanced bone strength.[8] This anabolic action is what defines teriparatide's unique place in the osteoporosis treatment armamentarium, offering a therapeutic option capable of rebuilding the skeleton rather than just preserving it.

Molecular and Biochemical Profile

Teriparatide is a precisely defined polypeptide, a product of advanced recombinant DNA technology. Its structure is optimized for biological activity, and its physicochemical properties are well-characterized, forming the foundation of its clinical use.

Amino Acid Sequence and Primary Structure

Teriparatide is a single-chain polypeptide that is identical in sequence to the first 34 amino acids of the N-terminus of the native 84-amino-acid human parathyroid hormone (hPTH).[7] This 1-34 fragment represents the biologically active region of the hormone, responsible for binding to its receptor and initiating downstream signaling.[10] The selection of this specific fragment is a key example of biopharmaceutical optimization; manufacturing a smaller, 34-amino-acid peptide is significantly less complex and more cost-effective than producing the full 84-amino-acid protein, a critical factor in developing it as a viable commercial therapeutic.

The primary amino acid sequence of teriparatide is as follows [7]:

Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe

Physicochemical Properties

Teriparatide is supplied for research and manufacturing as a white to off-white powder.[6] For clinical use, it is formulated as a sterile, clear, colorless, and isotonic solution for subcutaneous injection.[11] As a peptide, it requires specific storage conditions, typically refrigeration between 2°C and 8°C, and must be protected from light and not frozen to maintain its integrity.[5] The key identifiers and properties are summarized in Table 1.

Table 1: Key Physicochemical and Biochemical Properties of Teriparatide

Property	Teriparatide (Free Base)	Teriparatide Acetate	Source(s)
DrugBank ID	DB06285	DB06285	23
Type	Biotech	Biotech	23
CAS Number	52232-67-4	99294-94-7	5
Molecular Formula	C181​H291​N55​O51​S2​	C183​H295​N55​O53​S2​	5
Molecular Weight (Da)	4117.77	4177.83	5
Amino Acid Count	34	34	7
Amino Acid Sequence	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF	14
Appearance (Formulated)	Clear, colorless liquid	Clear, colorless liquid	11
ATC Code	H05AA02	H05AA02	7

Manufacturing via Recombinant DNA Technology

Teriparatide is classified as a biotech drug, produced using sophisticated recombinant DNA (rDNA) technology rather than conventional chemical synthesis for the commercial drug product.[11] The United States Pharmacopeia (USP) notes that teriparatide can be produced either by an rDNA-based method or by chemical synthesis, such as Solid Phase Peptide Synthesis (SPPS), providing regulatory flexibility for manufacturers.[15]

The originator product, Forteo®, is manufactured by Eli Lilly and Company using a genetically modified strain of the bacterium Escherichia coli.[11] The manufacturing process, as described by the European Medicines Agency (EMA), involves several key stages [27]:

1. Development Genetics and Cell Banking: A non-pathogenic E. coli K12 strain is transformed with a vector containing the gene for hPTH(1-34). Master and Working Cell Banks are established to ensure consistency.
2. Fermentation and Isolation: The engineered E. coli are grown in large-scale fermenters under controlled conditions to produce the peptide. In-process controls monitor cell growth and protect against contamination.
3. Purification: The crude peptide is isolated and subjected to a comprehensive purification process involving multiple chromatographic separations, tangential flow filtrations, and chemical reaction steps to achieve high purity.
4. Formulation: The purified peptide is formulated into the final drug product, a sterile solution containing excipients like glacial acetic acid, sodium acetate, mannitol, and metacresol as a preservative.[11] The solution is aseptically filled into glass cartridges, which are then assembled into the final pre-filled pen device.

The emergence of biosimilars has introduced alternative manufacturing platforms. For example, the biosimilar Bonsity® is produced using a modified strain of Pseudomonas fluorescens as the expression host.[13] This shift reflects ongoing advancements in protein expression systems, as different host organisms can offer advantages in protein folding, yield, and purity profiles. Regardless of the host system, all rDNA-produced teriparatide must meet stringent quality control standards, including limits on host cell-derived proteins and DNA, as approved by competent authorities.[15]

Pharmacodynamics: The Anabolic Window of Parathyroid Hormone

The therapeutic effect of teriparatide is rooted in a fascinating biological paradox: a hormone fragment that can either build or degrade bone depending entirely on the pattern of its administration. Understanding this principle is central to comprehending its mechanism of action.

High-Affinity Binding to the PTH1 Receptor

Teriparatide exerts its biological effects by binding to the parathyroid hormone 1 receptor (PTH1R), a class B G protein-coupled receptor located on the surface of target cells, primarily osteoblasts and kidney tubular cells.[10] Teriparatide, being identical to the N-terminal 1-34 sequence of endogenous PTH, binds to the PTH1R with the same high affinity and specificity as the native hormone, thereby initiating the same downstream physiological actions.[11]

The Paradox of Intermittent vs. Continuous Exposure

The skeletal effects of PTH are critically dependent on the temporal pattern of systemic exposure.[11] This duality is the cornerstone of teriparatide's clinical utility.

• Continuous Exposure (Catabolic Effect): Chronically elevated levels of PTH, such as those seen in primary hyperparathyroidism, result in a net catabolic state. In this scenario, bone resorption by osteoclasts is stimulated more than bone formation by osteoblasts, leading to a loss of bone mass and an increased risk of fractures.[10]
• Intermittent Exposure (Anabolic Effect): In stark contrast, the once-daily subcutaneous injection of teriparatide produces a transient, pulsatile spike in hormone concentration that lasts for only a few hours.[10] This intermittent signaling pattern preferentially stimulates osteoblastic activity over osteoclastic activity.[5] This "anabolic window" results in a net gain in bone mass, an increase in trabecular and cortical bone formation, and an overall improvement in bone strength.[10] The cellular response to PTH signaling is not linear; osteoblasts and osteoclasts appear to have different temporal sensitivities to the hormone. The short pulse from a daily injection seems to activate the bone-forming machinery of osteoblasts before the slower, more sustained bone-resorbing response of osteoclasts can dominate. This pharmacological manipulation transformed a hormone known for causing bone loss into a powerful bone-building therapy.

Intracellular Signaling Cascades

Upon binding of teriparatide to the PTH1R, two primary intracellular signaling pathways are activated [10]:

1. Adenylate Cyclase/cAMP Pathway: The receptor activates Gs proteins, which in turn stimulate the enzyme adenylate cyclase. This enzyme converts adenosine triphosphate (ATP) into the second messenger cyclic adenosine monophosphate (cAMP).[10] The rise in intracellular cAMP activates Protein Kinase A (PKA). PKA then phosphorylates a variety of downstream target proteins, including transcription factors like Runx2. This cascade leads to the increased expression of genes that promote osteoblast differentiation and function, while also inhibiting osteoblast apoptosis (programmed cell death) by upregulating anti-apoptotic proteins like Bcl-2.[10]
2. Phospholipase C/PKC Pathway: The PTH1R can also couple to Gq proteins, activating phospholipase C, which leads to the generation of inositol trisphosphate (IP3​) and diacylglycerol (DAG), ultimately activating Protein Kinase C (PKC).[28]

Modulation of Bone Turnover Markers (BTMs)

The net anabolic effect of teriparatide is reflected in characteristic changes in serum markers of bone turnover. Treatment leads to a rapid and substantial increase in markers of bone formation, such as procollagen type I N-terminal propeptide (P1NP) and osteocalcin.[11] Markers of bone resorption, such as the C-terminal telopeptide of type I collagen (CTX), also increase, as PTH signaling does stimulate osteoclasts. However, the magnitude and speed of the increase in formation markers are significantly greater than that of resorption markers, providing biochemical evidence of the net bone-forming effect.[11]

Systemic Effects on Calcium and Phosphate Homeostasis

Consistent with the known physiological actions of endogenous PTH, teriparatide has predictable effects on mineral metabolism.[11] Following a 20 mcg injection, serum calcium concentrations begin to rise at approximately 2 hours, reach a maximum concentration between 4 and 6 hours (a median increase of 0.4 mg/dL), and then decline back to baseline levels by 16 to 24 hours after the dose.[11] This transient hypercalcemia is a direct result of increased calcium reabsorption in the kidneys and mobilization of calcium from bone. Teriparatide also causes a transient decrease in serum phosphorus and an increase in urinary calcium excretion.[11]

A critical aspect of teriparatide's action is that its benefits extend beyond what can be measured by Bone Mineral Density (BMD) alone. A post-hoc analysis of the Fracture Prevention Trial found that teriparatide-related increases in lumbar spine BMD accounted for only 30% to 41% of the observed reduction in vertebral fracture risk.[36] The remainder of the risk reduction was attributed to improvements in non-BMD determinants of bone strength. This indicates that teriparatide significantly enhances bone

quality—improving elements like trabecular microarchitecture, increasing trabecular connectivity, and favorably altering cortical geometry—which are not fully captured by standard two-dimensional DXA scans but contribute profoundly to the skeleton's resistance to fracture.[8] This has important implications for clinicians, suggesting that a patient may be deriving substantial anti-fracture benefit even if BMD gains appear modest.

Clinical Pharmacokinetics (PK)

The pharmacokinetic profile of teriparatide is characterized by rapid absorption and elimination, a profile that is not merely a feature of the drug but the essential enabler of its unique anabolic mechanism.

Absorption, Distribution, Metabolism, and Excretion (ADME)

The journey of teriparatide through the body is well-defined and consistent across patient populations.

• Absorption: Following subcutaneous injection into the thigh or abdominal wall, teriparatide is absorbed rapidly and extensively. The absolute bioavailability is approximately 95%.[11] Peak serum concentrations (Cmax) are achieved quickly, at approximately 30 minutes post-injection.[30]
• Distribution: The volume of distribution following intravenous administration is approximately 0.12 L/kg, indicating that the drug is primarily distributed within the plasma and extracellular fluid compartments.[11]
• Metabolism: Specific metabolism studies have not been performed for teriparatide. However, based on the known fate of endogenous PTH, it is believed to undergo peripheral metabolism into smaller peptide fragments primarily through non-specific enzymatic mechanisms in the liver (likely by Kupffer cells) and other tissues.[11] The systemic clearance is rapid (approximately 62 L/hr in women and 94 L/hr in men), exceeding the rate of normal liver plasma flow, which confirms that clearance occurs in both hepatic and extra-hepatic sites.[11]
• Excretion: The peptide fragments resulting from metabolism are cleared from the circulation mainly via the kidneys.[11]
• Half-Life (T1/2​): The elimination half-life of teriparatide is brief. When administered intravenously, its half-life in serum is about 5 minutes. Following subcutaneous administration, the apparent half-life is approximately 1 hour; this longer duration reflects the time required for the drug to be absorbed from the injection site into the systemic circulation.[30] Serum concentrations decline to non-quantifiable levels within 3 hours of a dose, and importantly, no drug accumulation occurs with once-daily dosing.[31]

This pharmacokinetic profile is perfectly tailored to the drug's pharmacodynamic requirements. The rapid absorption and elimination are precisely what create the short, pulsatile spike of PTH exposure necessary to activate the "anabolic window." A longer half-life or drug accumulation would lead to continuous receptor stimulation, mimicking hyperparathyroidism and resulting in a net catabolic effect on bone. Thus, the drug's PK profile is the direct cause of its therapeutic effect.

Influence of Patient Factors

The pharmacokinetics of teriparatide are largely consistent across different patient demographics.

• Sex: Men exhibit a systemic clearance that is approximately 50% higher than in women, resulting in a systemic exposure (AUC) that is 20-30% lower. However, these differences are not considered clinically significant, and the recommended 20 mcg dose is the same for both men and women.[31]
• Renal Impairment: In patients with mild to moderate renal impairment (creatinine clearance [CrCl] 30 to 72 mL/min), no clinically meaningful differences in pharmacokinetics were observed. However, in patients with severe renal impairment (CrCl <30 mL/min), the AUC and half-life of teriparatide were increased by 73% and 77%, respectively. The clinical implications of this increased exposure in patients with severe renal disease are not fully established.[31]
• Hepatic Impairment: As teriparatide is metabolized by non-specific proteolytic enzymes present in the liver and other tissues, hepatic impairment is not expected to significantly alter its clearance. However, no formal studies have been conducted in this population.[11]
• Other Factors: Pharmacokinetic analyses have shown no major differences related to age, race (though data in non-Caucasian patients are limited), body weight, heart failure, alcohol consumption, or smoking status.[31]

Table 2: Summary of Pharmacokinetic Parameters of Teriparatide (20 mcg Subcutaneous Dose)

Parameter	Value / Finding	Comment / Source(s)
Absolute Bioavailability	~95%	Rapid and extensive absorption from subcutaneous tissue. 11
Time to Peak Concentration (Tmax​)	~30 minutes	Characterizes the rapid onset of the pulse. 30
Elimination Half-Life (T1/2​)	~1 hour	Reflects absorption time from the injection site; ensures transient exposure. 30
Time to Undetectable Levels	~3 hours	Confirms the pulsatile nature of the therapy with no accumulation. 31
Volume of Distribution (Vd​)	~0.12 L/kg	Distribution is primarily in plasma and extracellular fluid. 11
Systemic Clearance	~62 L/hr (women), ~94 L/hr (men)	Exceeds hepatic blood flow, indicating both hepatic and extra-hepatic clearance. 11
Effect of Severe Renal Impairment (CrCl <30 mL/min)	AUC increased by 73%, T1/2​ increased by 77%	Exposure is significantly increased; clinical impact not fully defined. 31
Effect of Sex	AUC is 20-30% lower in men	Difference is not considered clinically significant; no dose adjustment needed. 31

Evidence of Clinical Efficacy: A Review of Landmark Trials

The clinical utility of teriparatide is supported by a robust body of evidence from randomized controlled trials (RCTs) and extensive real-world experience, establishing its efficacy in reducing fracture risk in key high-risk populations.

Approved Indications

Teriparatide is specifically indicated for the treatment of osteoporosis in patients who are at a high risk for fracture. The approved indications are [21]:

1. Treatment of postmenopausal women with osteoporosis at high risk for fracture.
2. Increase of bone mass in men with primary or hypogonadal osteoporosis at high risk for fracture.
3. Treatment of men and women with osteoporosis associated with sustained systemic glucocorticoid therapy (GIO) at high risk for fracture.

In this context, "high risk" is generally defined as having a history of osteoporotic fracture, the presence of multiple risk factors for fracture, or having failed or being intolerant to other available osteoporosis therapies.[23]

Postmenopausal Osteoporosis: The Fracture Prevention Trial (FPT)

The cornerstone of teriparatide's approval was the Fracture Prevention Trial (FPT), registered as NCT00670501.[36] This pivotal, randomized, double-blind, placebo-controlled study enrolled 1,637 postmenopausal women with pre-existing vertebral fractures.[36] As previously noted, the trial was terminated early after a median treatment duration of 19 months due to the osteosarcoma finding in rats.[1]

Despite its early termination, the results were compelling. Compared to placebo, the 20 mcg daily dose of teriparatide (the approved dose) was shown to [3]:

• Reduce the risk of new vertebral fractures by 65%.
• Reduce the risk of non-vertebral fragility fractures by 53%.
• Significantly increase BMD at the lumbar spine and femoral neck.

This trial provided the foundational evidence for teriparatide's potent anti-fracture efficacy, particularly at the spine.

Male Osteoporosis

In a randomized, placebo-controlled trial involving 437 men with primary or hypogonadal osteoporosis, teriparatide treatment for a median of 11 months resulted in significant increases in BMD. Lumbar spine BMD increased by 5.9% and femoral neck BMD by 1.5% compared to placebo.[41] While the effect on fracture incidence was not a primary endpoint in this trial, the BMD gains were comparable to those seen in postmenopausal women, providing the basis for its approval in this population.[41]

Glucocorticoid-Induced Osteoporosis (GIO)

Teriparatide's efficacy in GIO was established in a landmark 18-month, randomized, double-blind trial that compared it directly to alendronate, a potent bisphosphonate and the standard of care. In patients receiving sustained glucocorticoid therapy, teriparatide demonstrated clear superiority [4]:

• It produced significantly greater increases in lumbar spine BMD (+7.2% vs. +3.4% for alendronate).
• It led to a significantly lower incidence of new vertebral fractures (0.6% vs. 6.1% for alendronate).

This trial was crucial as it demonstrated teriparatide's superiority over an active, effective comparator in a particularly vulnerable patient population where bone formation is suppressed.

Real-World Evidence and Head-to-Head Comparative Trials

The evidence from initial RCTs has been strongly corroborated and expanded upon by subsequent studies.

• The VERO Trial (NCT00696644): This head-to-head trial compared teriparatide with risedronate in 1,360 postmenopausal women with severe osteoporosis. After 24 months, teriparatide was significantly more effective at reducing new vertebral fractures (5.4% vs. 12.0% for risedronate; 56% relative risk reduction) and clinical fractures (4.8% vs. 9.8%; 52% relative risk reduction).[42] This was the first trial to show a significant fracture reduction outcome as a primary endpoint in a head-to-head comparison of osteoporosis drugs.
• Real-World Studies: Data from large observational studies and patient registries, such as the European Forsteo Observational Study, have consistently confirmed the fracture and BMD benefits seen in RCTs across all approved patient populations.[33] Some of these large-scale analyses have also demonstrated a significant reduction in hip fractures, an endpoint that was not consistently met in individual RCTs due to lower event rates.[43]
• Combination Therapy Trials: Studies like DATA and DATA-Switch have explored combining teriparatide with denosumab, showing synergistic effects that lead to even greater BMD gains than either drug used alone, highlighting its potent anabolic capacity.[34]

This progression of evidence—from placebo-controlled trials to active-comparator trials and finally to large-scale real-world data—builds an exceptionally strong and consistent case for teriparatide's efficacy in reducing vertebral fractures in patients with severe osteoporosis.

Table 3: Efficacy Outcomes from Pivotal Teriparatide Clinical Trials

Trial / Population	Comparator	Duration	Key Efficacy Results (vs. Comparator)	Source(s)
Fracture Prevention Trial (FPT) (Postmenopausal Women)	Placebo	Median 19 months	Vertebral Fracture Risk Reduction: -65% Non-Vertebral Fracture Risk Reduction: -53% Lumbar Spine BMD Change: Significant increase	3
GIO Trial (Men and Women on Glucocorticoids)	Alendronate	18 months	Vertebral Fracture Incidence: 0.6% vs. 6.1% Lumbar Spine BMD Change: +7.2% vs. +3.4%	4
VERO Trial (NCT00696644) (Postmenopausal Women)	Risedronate	24 months	Vertebral Fracture Risk Reduction: -56% (5.4% vs. 12.0%) Clinical Fracture Risk Reduction: -52% (4.8% vs. 9.8%)	42
Male Osteoporosis Trial (Men with Primary/Hypogonadal Osteoporosis)	Placebo	Median 11 months	Lumbar Spine BMD Change: +5.9% Femoral Neck BMD Change: +1.5%	41

Comparative Therapeutic Landscape

Choosing an osteoporosis therapy for a high-risk patient requires a nuanced understanding of the relative strengths and weaknesses of the available agents. Teriparatide's position is defined by its unique anabolic mechanism when compared to potent antiresorptives like bisphosphonates and denosumab.

Teriparatide vs. Bisphosphonates

This comparison pits a bone-forming agent against a class of bone resorption inhibitors.

• Mechanism of Action: Teriparatide is anabolic, stimulating new bone formation.[8] Bisphosphonates are antiresorptive, inhibiting osteoclast activity to reduce bone breakdown.[8]
• Efficacy on Bone Mineral Density (BMD): Head-to-head trials and meta-analyses consistently demonstrate that teriparatide leads to significantly greater increases in lumbar spine BMD compared to oral bisphosphonates like alendronate and risedronate.[8] In one trial, after a median of 14 months, lumbar spine BMD increased by 12.2% with teriparatide versus 5.6% with alendronate.[8] Meta-analyses also show teriparatide is superior for increasing femoral neck and total hip BMD.[47]
• Efficacy on Fractures: Teriparatide has demonstrated superiority in fracture reduction. The VERO trial showed a 56% lower risk of new vertebral fractures compared to risedronate.[42] A large meta-analysis of 23 trials found that teriparatide was superior to bisphosphonates in decreasing the overall risk of fracture (Risk Ratio = 0.61), a benefit not seen with denosumab in the same analysis.[47]
• Safety: The overall incidence of adverse events is generally comparable between teriparatide and bisphosphonates.[47] The side effect profiles are, however, different, with teriparatide associated with hypercalcemia and dizziness, and oral bisphosphonates associated with upper gastrointestinal issues.

Teriparatide vs. Denosumab

This comparison is between the leading anabolic agent and the most potent antiresorptive agent.

• Mechanism of Action: Teriparatide is anabolic.[10] Denosumab is a monoclonal antibody that binds to RANKL, potently inhibiting osteoclast formation and function, making it a powerful antiresorptive.[9]
• Efficacy on BMD: This is a more complex comparison. Head-to-head data from the DATA trial and subsequent meta-analyses suggest that denosumab produces greater increases in BMD at cortical-rich sites like the total hip and femoral neck. At the trabecular-rich lumbar spine, the agents are more comparable, with some studies favoring teriparatide.[9] In patients switching from long-term bisphosphonate use, one observational study found that those who switched to teriparatide had higher annualized BMD gains at the spine (+1.3%) but lower gains at the total hip (-2.2%) compared to those who switched to denosumab.[50] This suggests a transient loss of hip BMD in the first year of teriparatide therapy in this pre-treated population.
• Efficacy on Fractures: Direct comparative fracture data is very limited. However, an indirect comparison via a meta-analysis showed that against bisphosphonates, teriparatide significantly reduced fracture risk (RR=0.61), whereas denosumab did not (RR=0.99).[47] This disconnect—where both drugs are highly effective at increasing BMD but may differ in fracture reduction efficacy relative to bisphosphonates—reinforces the concept that teriparatide's mechanism confers benefits to bone quality and microarchitecture that are not fully captured by BMD measurements.
• Safety: Some analyses suggest teriparatide may have a more favorable safety profile, with a lower incidence of overall adverse events compared to denosumab.[9]

The Role of Combination and Sequential Therapy

The distinct mechanisms of these drugs have led to investigations into strategic pairings.

• Combination Therapy: Attempts to combine teriparatide with bisphosphonates have been disappointing, with some evidence suggesting that the profound suppression of bone turnover by alendronate may blunt the anabolic effect of teriparatide.[34] In contrast, combining teriparatide with denosumab has shown synergistic effects. The DATA trial demonstrated that this combination leads to substantially greater BMD increases at both the spine and hip than either monotherapy, likely because denosumab effectively blocks the resorption component of the remodeling stimulated by teriparatide.[34]
• Sequential Therapy: It is the undisputed standard of care to follow a course of teriparatide with an antiresorptive agent. Because the bone-forming effects of teriparatide are transient, the newly formed bone is vulnerable to resorption once treatment is stopped. Initiating a bisphosphonate or denosumab immediately after completing the teriparatide course is critical to "lock in" and maintain the BMD gains achieved.[20] This positions teriparatide not as a standalone cure, but as a powerful, time-limited "bone-building phase" within a longer-term osteoporosis management strategy.

Table 4: Comparative Efficacy of Teriparatide, Bisphosphonates, and Denosumab

Feature	Teriparatide	Bisphosphonates (Oral)	Denosumab	Source(s)
Mechanism of Action	Anabolic (stimulates bone formation)	Antiresorptive (inhibits bone resorption)	Potent Antiresorptive (inhibits bone resorption)	8
Lumbar Spine BMD Change	Superior	Inferior to Teriparatide & Denosumab	Superior to Bisphosphonates; comparable to Teriparatide	8
Total Hip BMD Change	Superior to Bisphosphonates; may be inferior to Denosumab	Inferior to Teriparatide & Denosumab	Superior to Bisphosphonates & Teriparatide	47
Vertebral Fracture Reduction	Superior to Bisphosphonates	Standard efficacy	Efficacy established vs. placebo	42
Non-Vertebral Fracture Reduction	Superior to Bisphosphonates	Standard efficacy	Efficacy established vs. placebo	8
Key Head-to-Head Finding	Superior to risedronate for reducing vertebral fractures (VERO Trial)	Inferior to teriparatide for BMD and vertebral fracture reduction	Produces greater hip BMD gains than teriparatide (DATA Trial)	8

Comprehensive Safety and Tolerability Profile

Teriparatide is generally well-tolerated, but its use requires an understanding of its specific adverse effect profile, key warnings, and contraindications. The evolution of its safety label, particularly concerning osteosarcoma, is a critical part of its story.

Common and Serious Adverse Reactions

The most frequently reported adverse reactions in clinical trials are generally mild to moderate in severity.

• Most Common Adverse Reactions (incidence >10%): The most common side effects associated with teriparatide are arthralgia (joint pain), pain in general, and nausea.[21]
• Other Common Events: Other frequently reported symptoms include leg cramps, dizziness, headache, depression, and injection site reactions (such as redness, pain, swelling, bruising, or itching).[22] Heartburn or sour stomach has also been reported.[22]
• Orthostatic Hypotension: A notable serious adverse event is transient orthostatic hypotension. This can manifest as dizziness, lightheadedness, fast heartbeat, or fainting upon standing up from a lying or sitting position.[22] These episodes typically occur within the first 4 hours of dosing, are most common with the initial several doses, and usually resolve spontaneously within a few minutes to a few hours. To mitigate this risk, patients are instructed to administer their first few injections in a setting where they can sit or lie down immediately if symptoms occur.[20]

Table 5: Common Adverse Reactions with Teriparatide (Incidence ≥2% and > Placebo in Osteoporosis Trials)

System Organ Class	Adverse Reaction	Teriparatide 20 mcg (%)	Placebo (%)	Source(s)
Body as a Whole	Pain	21.3	20.5	35
	Headache	7.5	7.4	21
	Asthenia	8.7	6.8	21
	Neck pain	3.0	2.7	21
Cardiovascular	Hypertension	6.6	5.7	21
	Angina Pectoris	2.5	1.6	21
	Syncope	2.5	1.4	21
Digestive System	Nausea	14.1	8.4	21
	Constipation	5.4	4.5	21
	Diarrhea	5.1	4.6	21
	Dyspepsia	5.2	4.1	21
	Vomiting	3.0	2.3	21
Musculoskeletal	Arthralgia	10.1	8.4	21
	Leg cramps	2.6	1.3	2
Nervous System	Dizziness	8.0	5.4	2
	Depression	4.1	2.7	21
	Insomnia	4.3	3.8	21
Respiratory System	Rhinitis	9.6	8.8	21
	Dyspnea	3.6	2.6	21
Skin and Appendages	Rash	4.9	4.4	21

In-depth Review of Key Warnings

• Hypercalcemia: Due to its mechanism of action, teriparatide causes transient increases in serum calcium.[11] For this reason, it should be avoided in patients with pre-existing hypercalcemic disorders, such as primary hyperparathyroidism.[21] While the hypercalcemia is usually mild and asymptomatic, patients should be advised to contact their physician if they experience persistent symptoms like nausea, vomiting, constipation, lethargy, or muscle weakness.[22] This effect also underlies a clinically significant drug interaction: the transient hypercalcemia can predispose patients taking digoxin to digitalis toxicity, requiring cautious co-administration.[21]
• Urolithiasis (Kidney Stones): Teriparatide increases urinary calcium excretion, which can potentially form or exacerbate kidney stones.[51] Although clinical trials did not show an increased frequency of urolithiasis compared to placebo, the drug has not been studied in patients with active urolithiasis. Therefore, the risk and benefit should be carefully considered in patients with an active or recent history of kidney stones.[21]
• Cutaneous Calcification and Calciphylaxis: Rare but serious post-marketing reports have described calciphylaxis (a syndrome of vascular calcification and skin necrosis) and the worsening of pre-existing cutaneous calcification. Risk factors include underlying kidney failure, autoimmune disease, and concomitant use of warfarin or corticosteroids. Teriparatide should be discontinued if these conditions develop.[21]

The Osteosarcoma Risk: Deconstruction of a Decades-Long Concern

The history of the osteosarcoma risk associated with teriparatide is a textbook case of diligent pharmacovigilance and the evolution of risk assessment based on accumulating evidence.

1. Preclinical Origin: The concern originated entirely from preclinical toxicology studies in Fischer 344 rats. These rats, when treated with high doses of teriparatide for a duration equivalent to most of their lifespan, showed an increased incidence of osteosarcoma.[1]
2. Initial Regulatory Response: Acting with caution, the FDA mandated a "black box" warning—the most serious type—on the Forteo® label. This warning highlighted the rat finding and advised against use in patients with an increased baseline risk for osteosarcoma. A lifetime treatment limit of two years was also imposed as a risk mitigation strategy.[2]
3. Accumulation of Human Evidence: Over the subsequent two decades, a massive amount of human safety data was collected through post-marketing surveillance. This included a prospective patient registry and multiple observational studies, ultimately encompassing over 2.5 million patient-years of exposure. These extensive human studies have not observed an increased risk of osteosarcoma in patients treated with teriparatide compared to the general population.[41]
4. Label Evolution: Based on the overwhelming weight of this human safety data, the FDA concluded that the risk observed in rats did not translate to humans. In 2020, the agency removed the boxed warning from the U.S. label.[53] The 2-year lifetime use limitation was also revised to a recommendation, stating that treatment beyond two years "should only be considered if a patient remains at or has returned to having a high risk for fracture".[21] This evolution fundamentally changes the long-term risk-benefit calculation, providing clinicians with greater flexibility for re-treatment or extended treatment in select patients with severe, ongoing disease.

Contraindications and Drug Interactions

Based on the safety profile, teriparatide use is contraindicated or should be avoided in specific populations.

• Contraindications: The primary contraindication is known hypersensitivity to teriparatide or its excipients, which can manifest as angioedema or anaphylaxis.[21]
• Populations to Avoid: Use should be avoided in patients with an increased baseline risk of osteosarcoma. This includes [21]:
• Patients with Paget's disease of bone or other metabolic bone diseases besides osteoporosis.
• Patients with unexplained elevations of alkaline phosphatase.
• Pediatric and young adult patients with open epiphyses (growing bones).
• Patients with a history of bone metastases or skeletal malignancies.
• Patients who have received prior external beam or implant radiation therapy involving the skeleton.
• Patients with hereditary disorders that predispose them to osteosarcoma.
• Drug Interactions: The most significant interaction is with digoxin, due to the potential for transient hypercalcemia to precipitate digitalis toxicity.[21] Interactions with diuretics like hydrochlorothiazide and furosemide have been studied but are not considered clinically important.[52]

Regulatory and Commercial Trajectory

Teriparatide's journey from a novel concept to a globally available therapy has been marked by key regulatory milestones and a shifting market landscape driven by the advent of biosimilars.

Global Approval History and Label Evolution

• United States (FDA): Teriparatide was first approved by the FDA in November 2002 under the brand name Forteo®, marketed by Eli Lilly and Company.[2] The initial approval came with a boxed warning regarding the risk of osteosarcoma and a recommended lifetime treatment duration of two years. A pivotal moment in its regulatory history occurred in 2020 when, after reviewing extensive post-marketing safety data, the FDA removed the boxed warning.[53] The guidance on the two-year treatment limit was also softened to allow for consideration of longer or repeat courses in patients who remain at high fracture risk.[21]
• Europe (EMA): The European Medicines Agency granted marketing authorisation for teriparatide under the brand name Forsteo® in June 2003.[7] The EMA has been proactive in the approval of biosimilar versions. The first biosimilar, Movymia®, was authorized in January 2017, followed shortly by Terrosa® in the same year.[58] This earlier introduction of biosimilars in the European market compared to the U.S. has accelerated the shift towards a more competitive landscape.

Market Landscape: Brand-Name Products and the Emergence of Biosimilars

The market for teriparatide has evolved from a single-product monopoly to a competitive environment.

• Originator Product: Forteo® (in the U.S.) and Forsteo® (in the EU) are the original brand-name products developed and marketed by Eli Lilly and Company.[2]
• Biosimilars: The expiration of key patents has opened the door for the development and launch of biosimilar versions, which are highly similar to the originator product in terms of quality, safety, and efficacy. The availability of these lower-cost alternatives is a significant development for healthcare systems and patients.
• In the United States: Bonsity®, a teriparatide injection developed by Pfenex Inc. and commercialized by Alvogen, was approved by the FDA in October 2019 and launched in June 2020.[12]
• In Europe: A number of biosimilars are available, including Movymia®, Sondelbay®, Terrosa®, and Teriparatide Teva®.[58]
• Product Formulation: Both the originator and biosimilar products are typically supplied as a sterile solution in a multi-dose, pre-filled pen device designed for once-daily, subcutaneous self-injection. Each pen generally contains 28 daily doses of 20 mcg.[11]

The introduction of biosimilars is expected to have a profound impact on the clinical use of teriparatide. Historically, its high cost has been a significant barrier, often relegating it to a last-resort option for only the most severe cases of osteoporosis.[23] The availability of more affordable biosimilars is likely to increase patient access and may encourage its use earlier in the treatment pathway for patients with very high fracture risk, aligning with evolving clinical guidelines that recommend an "anabolic-first" approach for severe disease.[3]

Clinical Recommendations and Future Perspectives

The integration of teriparatide into clinical practice requires careful patient selection, diligent monitoring, and a forward-thinking approach to long-term management and future research.

Optimal Patient Selection and Dosing

The ideal candidate for teriparatide therapy is a patient with severe osteoporosis who is at a high risk for fracture. This includes individuals with [3]:

• A history of multiple or severe vertebral fractures.
• A very low Bone Mineral Density (BMD) T-score (e.g., ≤ -3.5).
• Fractures that have occurred despite treatment with an antiresorptive agent.
• Intolerance or contraindications to other osteoporosis therapies.
• High-risk glucocorticoid-induced osteoporosis.

The standard and recommended dosage is 20 mcg administered subcutaneously once a day.[20] It is essential that patients also maintain adequate intake of supplemental calcium and vitamin D, as these are necessary substrates for the new bone being formed.[20]

Monitoring Therapeutic Response and Safety

Effective management with teriparatide involves both clinical and laboratory monitoring.

• Safety Monitoring: Given the risk of transient hypercalcemia, a serum calcium level can be checked approximately one month after initiating therapy and periodically thereafter as clinically indicated.[22] Patients should be monitored for symptoms of orthostatic hypotension with the initial doses.
• Efficacy Monitoring: While changes in BMD are often tracked, clinicians must recognize that the anti-fracture benefits of teriparatide may precede and exceed what is reflected in BMD measurements.[36] Increases in bone turnover markers, particularly the formation marker P1NP, can provide early evidence of the drug's anabolic effect.[33] However, the ultimate measure of success is the prevention of new fractures.

Transitioning to Antiresorptive Therapy Post-Teriparatide

A critical component of a successful teriparatide treatment strategy is planning for what comes next. The bone mass gained during the anabolic phase is vulnerable to being lost once the treatment is discontinued. Therefore, it is the standard of care to transition patients immediately to an antiresorptive agent, such as a bisphosphonate or denosumab, upon completion of the teriparatide course. This sequential therapy approach is essential to consolidate and maintain the newly formed bone, preserving the therapeutic benefit.[20]

Unresolved Questions and Future Research Directions

Despite two decades of clinical use, several important questions about teriparatide remain, representing key areas for future research:

• Optimal Duration and Re-treatment: With the removal of the osteosarcoma boxed warning, research is needed to define the optimal duration of therapy beyond two years and to establish the safety and efficacy of re-treating patients with a second course of teriparatide after an intervening period on an antiresorptive.
• Combination Therapy: While the combination of teriparatide and denosumab shows impressive BMD gains, large-scale trials are needed to determine if this translates to superior fracture risk reduction and to define its place in routine clinical practice.[34]
• Predictors of Response: Identifying reliable clinical or genetic markers that predict which patients will have the most robust response to teriparatide would allow for better personalization of therapy and maximization of its benefits.
• Long-Term Outcomes: More data is needed on long-term fracture outcomes, particularly in men and pre-menopausal women with osteoporosis, to further refine its use in these specific populations.

References

[1]

Works cited

1. Present at the beginning: a personal reminiscence on the history of teriparatide - PubMed, accessed July 22, 2025, https://pubmed.ncbi.nlm.nih.gov/21452026/
2. New Study to Give Insight into Teriparatide use in the Real World ..., accessed July 22, 2025, https://investor.lilly.com/news-releases/news-release-details/new-study-give-insight-teriparatide-use-real-world-setting
3. Update on the safety and efficacy of teriparatide in the treatment of osteoporosis - PMC, accessed July 22, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC6778993/
4. Teriparatide: Label changes and identifying patients for long-term use, accessed July 22, 2025, https://www.ccjm.org/content/88/9/489
5. Teriparatide acetate | CAS#99294-94-7 | 52232-67-4 | parathyroid hormone | MedKoo, accessed July 22, 2025, https://www.medkoo.com/products/9287
6. Teriparatide Acetate - LKT Labs, accessed July 22, 2025, https://lktlabs.com/product/teriparatide-acetate/
7. Teriparatide - PubChem, accessed July 22, 2025, https://pubchem.ncbi.nlm.nih.gov/compound/Teriparatide
8. Randomized Double-Blind Trial to Compare the Efficacy of Teriparatide [Recombinant Human Parathyroid Hormone (1–34)] with Alendronate in Postmenopausal Women with Osteoporosis | The Journal of Clinical Endocrinology & Metabolism | Oxford Academic, accessed July 22, 2025, https://academic.oup.com/jcem/article/87/10/4528/2846443
9. Denosumab, teriparatide and bisphosphonates for ... - Frontiers, accessed July 22, 2025, https://www.frontiersin.org/journals/pharmacology/articles/10.3389/fphar.2024.1336075/full
10. What is the mechanism of Teriparatide? - Patsnap Synapse, accessed July 22, 2025, https://synapse.patsnap.com/article/what-is-the-mechanism-of-teriparatide
11. FORTEO - accessdata.fda.gov, accessed July 22, 2025, https://www.accessdata.fda.gov/drugsatfda_docs/label/2008/021318s015lbl.pdf
12. Teriparatide - Wikipedia, accessed July 22, 2025, https://en.wikipedia.org/wiki/Teriparatide
13. APPLICATION NUMBER: - 211939Orig1s000 PRODUCT QUALITY REVIEW(S) - accessdata.fda.gov, accessed July 22, 2025, https://www.accessdata.fda.gov/drugsatfda_docs/nda/2019/211939Orig1s000ChemR.pdf
14. Forteo | C183H295N55O53S2 | CID 132451761 - PubChem, accessed July 22, 2025, https://pubchem.ncbi.nlm.nih.gov/compound/Forteo
15. Teriparatide Type of Posting Revision Bulletin Posting Date 29-Mar-2024 Official Date 1-Apr-2024 Expert Committee Biologics Mono - USP-NF, accessed July 22, 2025, https://www.uspnf.com/sites/default/files/usp_pdf/EN/USPNF/revisions/teriparatide-rb-notice-20240329.pdf
16. Teriparatide CAS 52232-67-4 Sigma-Aldrich, accessed July 22, 2025, https://www.sigmaaldrich.com/US/en/product/sial/phr8659
17. pTH (1-34) (human) Acetate - Bachem, accessed July 22, 2025, https://www.bachem.com/all-generic-apis/pth-1-34-human-acetate/
18. H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH.CH3CO2H.H2O - PubChem, accessed July 22, 2025, https://pubchem.ncbi.nlm.nih.gov/compound/Teriparatide-acetate-hydrate
19. Parathyroid hormone (1-34) (human) - R&D Systems, accessed July 22, 2025, https://www.rndsystems.com/products/parathyroid-hormone-1-34-human_3011
20. Forteo Dosage Guide - Drugs.com, accessed July 22, 2025, https://www.drugs.com/dosage/forteo.html
21. teriparatide injection - accessdata.fda.gov, accessed July 22, 2025, https://www.accessdata.fda.gov/drugsatfda_docs/label/2024/218771s000lbl.pdf
22. Teriparatide Injection: MedlinePlus Drug Information, accessed July 22, 2025, https://medlineplus.gov/druginfo/meds/a603018.html
23. go.drugbank.com, accessed July 22, 2025, https://go.drugbank.com/drugs/DB06285#:~:text=Teriparatide%20is%20indicated%3A,to%20other%20available%20osteoporosis%20therapy.
24. Teriparatide Free Base | CAS #52232-67-4 (free base) | osteoporosis - MedKoo Biosciences, accessed July 22, 2025, https://www.medkoo.com/products/48449
25. Teriparatide - brand name list from Drugs.com, accessed July 22, 2025, https://www.drugs.com/ingredient/teriparatide.html
26. SUMMARY OF PRODUCT, accessed July 22, 2025, https://docs.cinnagen.com/wp-content/uploads/2018/10/CinnoPar-Teriparatide.pdf
27. Forsteo, INN-teriparatide - EMA, accessed July 22, 2025, https://www.ema.europa.eu/en/documents/scientific-discussion/forsteo-epar-scientific-discussion_en.pdf
28. teriparatide - PharmGKB, accessed July 22, 2025, https://www.pharmgkb.org/chemical/PA451620
29. Teriparatide - StatPearls - NCBI Bookshelf, accessed July 22, 2025, https://www.ncbi.nlm.nih.gov/books/NBK559248/
30. Pharmacokinetics of Teriparatide (rhPTH[1–34]) and Calcium Pharmacodynamics in Postmenopausal Women with Osteoporosis - PubMed Central, accessed July 22, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC2978887/
31. What is known about the pharmacokinetics of FORTEO® (teriparatide injection)? | Lilly Medical, accessed July 22, 2025, https://medical.lilly.com/us/products/assets/vaultpdf/en/cadb07d1caf804ad9a5bb8da9e952032b54055043ff5b88edc8817f27462ffec/what-is-known-about-the-pharmacokinetics-of-forteo-teriparatide-injection
32. Teriparatide in postmenopausal osteoporosis: uncovering novel ..., accessed July 22, 2025, https://eor.bioscientifica.com/view/journals/eor/9/9/EOR-23-0205.xml
33. Review of Current Real-World Experience with Teriparatide as Treatment of Osteoporosis in Different Patient Groups - ResearchGate, accessed July 22, 2025, https://www.researchgate.net/publication/350571931_Review_of_Current_Real-World_Experience_with_Teriparatide_as_Treatment_of_Osteoporosis_in_Different_Patient_Groups
34. Efficacy of the Combination of Teriparatide and Denosumab in the Treatment of Postmenopausal Osteoporosis: A Meta-Analysis - Frontiers, accessed July 22, 2025, https://www.frontiersin.org/journals/pharmacology/articles/10.3389/fphar.2022.888208/full
35. What are the common adverse reactions associated with FORTEO® (teriparatide injection)?, accessed July 22, 2025, https://medical.lilly.com/us/products/answers/what-are-the-common-adverse-reactions-associated-with-forteo-teriparatide-injection-26358
36. Teriparatide Relies on More than Bone Mineral Density to Reduce Vertebral Fracture Risk in Postmenopausal Women with Osteoporosis | Eli Lilly and Company, accessed July 22, 2025, https://investor.lilly.com/news-releases/news-release-details/teriparatide-relies-more-bone-mineral-density-reduce-vertebral
37. Forteo (teriparatide) C8523-A_R - Molina Healthcare, accessed July 22, 2025, https://www.molinahealthcare.com/providers/tx/PDF/Marketplace/Pharmacy/RXSC2019087.pdf
38. TERIPARATIDE INJECTION - accessdata.fda.gov, accessed July 22, 2025, https://www.accessdata.fda.gov/drugsatfda_docs/label/2025/218771Orig1s001lbl.pdf
39. Teriparatide: Uses, Interactions, Mechanism of Action | DrugBank Online, accessed July 22, 2025, https://go.drugbank.com/drugs/DB06285
40. Study Details | Effects of Teriparatide in the Treatment of ..., accessed July 22, 2025, https://clinicaltrials.gov/study/NCT00670501
41. Review of Current Real-World Experience with Teriparatide as Treatment of Osteoporosis in Different Patient Groups, accessed July 22, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC8037129/
42. New Data on FORTEO® (teriparatide [rDNA origin] injection ..., accessed July 22, 2025, https://investor.lilly.com/news-releases/news-release-details/new-data-forteor-teriparatide-rdna-origin-injection-showed
43. Review of Current Real-World Experience with Teriparatide as ..., accessed July 22, 2025, https://www.mdpi.com/2077-0383/10/7/1403
44. Teriparatide Unknown Status Phase 4 Trials for Osteoporosis Treatment | DrugBank Online, accessed July 22, 2025, https://go.drugbank.com/drugs/DB06285/clinical_trials?conditions=DBCOND0015928&phase=4&purpose=treatment&status=unknown_status
45. Comparative efficacy of teriparatide and bisphosphonates or denosumab vs. teriparatide monotherapy in osteoporosis: a meta-analysis - Frontiers, accessed July 22, 2025, https://www.frontiersin.org/journals/pharmacology/articles/10.3389/fphar.2025.1605279/full
46. www.frontiersin.org, accessed July 22, 2025, https://www.frontiersin.org/journals/pharmacology/articles/10.3389/fphar.2024.1336075/full#:~:text=suggested%20that%20teriparatide%20was%20more,et%20al.%2C%202021)..&sa=D&source=editors&ust=1753174213358820&usg=AOvVaw1RQAXle2UPGCT_qSF-NIwI)
47. Efficacy and safety of teriparatide vs. bisphosphonates and denosumab vs. bisphosphonates in osteoporosis not previously treated with bisphosphonates: a systematic review and meta-analysis of randomized controlled trials - PubMed, accessed July 22, 2025, https://pubmed.ncbi.nlm.nih.gov/39312040/
48. Efficacy and safety of teriparatide vs. bisphosphonates and ..., accessed July 22, 2025, https://www.springermedizin.de/efficacy-and-safety-of-teriparatide-vs-bisphosphonates-and-denos/50031784
49. Efficacy and safety of denosumab and teriparatide versus oral bisphosphonates to treat postmenopausal osteoporosis: a systematic review and meta-analysis - ResearchGate, accessed July 22, 2025, https://www.researchgate.net/publication/384062605_Efficacy_and_safety_of_denosumab_and_teriparatide_versus_oral_bisphosphonates_to_treat_postmenopausal_osteoporosis_a_systematic_review_and_meta-analysis
50. Comparison of Teriparatide and Denosumab in Patients Switching From Long-Term Bisphosphonate Use | The Journal of Clinical Endocrinology & Metabolism | Oxford Academic, accessed July 22, 2025, https://academic.oup.com/jcem/article/104/11/5611/5526755
51. www.mayoclinic.org, accessed July 22, 2025, https://www.mayoclinic.org/drugs-supplements/teriparatide-subcutaneous-route/description/drg-20066280#:~:text=This%20medicine%20may%20increase%20levels,or%20stomach%2C%20or%20weight%20loss.
52. Teriparatide Interactions Checker - Drugs.com, accessed July 22, 2025, https://www.drugs.com/drug-interactions/teriparatide.html
53. What is the risk of cancer associated with Forteo (teriparatide) treatment for osteoporosis?, accessed July 22, 2025, https://www.droracle.ai/articles/152443/risk-of-cancer-with-forteo-patient-handout
54. Bone Modifiers – Teriparatide Drug Quantity Management Policy – Per Days, accessed July 22, 2025, https://static.cigna.com/assets/chcp/pdf/coveragePolicies/cnf/cnf_231_coveragepositioncriteria_teripararide_dqm_per_days.pdf
55. FORTEO® Post-Market Osteosarcoma Surveillance Program: Real-World Data Contributes to Label Change | RTI Health Solutions, accessed July 22, 2025, https://www.rtihs.org/updates-and-events/forteor-post-market-osteosarcoma-surveillance-program-real-world-data
56. Teriparatide - Injection - MyHealth Alberta, accessed July 22, 2025, https://myhealth.alberta.ca/Health/medications/pages/conditions.aspx?Hwid=fdb0360
57. Forsteo | European Medicines Agency (EMA), accessed July 22, 2025, https://www.ema.europa.eu/en/medicines/human/EPAR/forsteo
58. Movymia | European Medicines Agency (EMA), accessed July 22, 2025, https://www.ema.europa.eu/en/medicines/human/EPAR/movymia
59. The first biosimilar approved for the treatment of osteoporosis: results of a comparative pharmacokinetic/pharmacodynamic study - PMC, accessed July 22, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC6422976/
60. Forteo (teriparatide Injection) - LillyMedical, accessed July 22, 2025, https://medical.lilly.com/us/products/medical-information/bone/forteo
61. Pfenex Announces US Commercial Launch of Teriparatide Injection, accessed July 22, 2025, https://drug-dev.com/pfenex-announces-us-commercial-launch-of-teriparatide-injection/
62. Teriparatide - Treatment - Royal Osteoporosis Society, accessed July 22, 2025, https://theros.org.uk/information-and-support/osteoporosis/treatment/teriparatide/
63. Parathyroid Hormone and Teriparatide for the Treatment of Osteoporosis: A Review of the Evidence and Suggested Guidelines for Its Use - Oxford Academic, accessed July 22, 2025, https://academic.oup.com/edrv/article/26/5/688/2355192
64. Osteoporosis Completed Phase Trials for Teriparatide (DB06285) | DrugBank Online, accessed July 22, 2025, https://go.drugbank.com/indications/DBCOND0015928/clinical_trials/DB06285?phase=&status=completed
65. Teriparatide Completed Phase N/A Trials for Osteoporosis | DrugBank Online, accessed July 22, 2025, https://go.drugbank.com/drugs/DB06285/clinical_trials?conditions=DBCOND0015928&status=completed
66. Forteo Information : Teriparatide - Johns Hopkins Arthritis Center, accessed July 22, 2025, https://www.hopkinsarthritis.org/patient-corner/drug-information/teriparatide-forteo/
67. teriparatide | Ligand page - IUPHAR/BPS Guide to PHARMACOLOGY, accessed July 22, 2025, https://www.guidetopharmacology.org/GRAC/LigandDisplayForward?tab=structure&ligandId=4448
68. TERIPARATIDE - Inxight Drugs - ncats, accessed July 22, 2025, https://drugs.ncats.io/drug/10T9CSU89I
69. Overexpression of Recombinant Human Teriparatide, rhPTH (1-34) in Escherichia coli: An Innovative Gene Fusion Approach - Semantic Scholar, accessed July 22, 2025, https://pdfs.semanticscholar.org/70be/d68e34edc2c743e2920358df30d21f8c0e99.pdf
70. Teriparatide Ascend | European Medicines Agency (EMA), accessed July 22, 2025, https://www.ema.europa.eu/en/medicines/human/EPAR/teriparatide-ascend
71. Teriparatide (subcutaneous route) - Side effects & dosage - Mayo Clinic, accessed July 22, 2025, https://www.mayoclinic.org/drugs-supplements/teriparatide-subcutaneous-route/description/drg-20066280
72. Osteoporosis Injection Treatment | FORTEO® (teriparatide injection), accessed July 22, 2025, https://forteo.lilly.com/
73. Study Details | Forteo for the Treatment of Unexplained ..., accessed July 22, 2025, https://clinicaltrials.gov/study/NCT00697463
74. Early Effects of Parathyroid Hormone (PTH) on the Proximal Femur, accessed July 22, 2025, https://ctv.veeva.com/study/early-effects-of-parathyroid-hormone-pth-on-the-proximal-femur
75. Study Details | Teriparatide (Forteo) in the Treatment of Patients With Postoperative Hypocalcemia | ClinicalTrials.gov, accessed July 22, 2025, https://clinicaltrials.gov/study/NCT00623974
76. Two-Year Outcomes of Daily and Twice-Weekly Teriparatide Treatment in Postmenopausal Women with Severe Osteoporosis: A Randomized Non-Blinded Prospective Study, accessed July 22, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC11184152/
77. A Study for Teriparatide in Severe Osteoporosis (ISSO) - ClinicalTrials.gov, accessed July 22, 2025, https://clinicaltrials.gov/study/NCT00696644
78. A pilot study comparing daily teriparatide with monthly cycles of, accessed July 22, 2025, https://www.researchgate.net/publication/350917718_A_pilot_study_comparing_daily_teriparatide_with_monthly_cycles_of_teriparatide_and_raloxifene
79. Study Details | Effects of Teriparatide in the Treatment of Postmenopausal Women With Osteoporosis | ClinicalTrials.gov, accessed July 22, 2025, https://www.clinicaltrials.gov/study/NCT00670501?term=Teriparatide&rank=8
80. Study Results | Evaluation of the Effects of Teriparatide on Skeleton Images in Postmenopausal Women With Osteoporosis | ClinicalTrials.gov, accessed July 22, 2025, https://www.clinicaltrials.gov/study/NCT00259298?term=TECHNETIUM%20TC-99M%20MEDRONATE&rank=6&tab=results
81. Review of Current Real-World Experience with Teriparatide as Treatment of Osteoporosis in Different Patient Groups - MDPI, accessed July 22, 2025, https://www.mdpi.com/2077-0383/10/7/1403/review_report
82. Overexpression of Recombinant Human Teriparatide, rhPTH (1-34) in Escherichia coli: An Innovative Gene Fusion Approach - AJMB, accessed July 22, 2025, https://www.ajmb.org/article?id=262
83. TERIPARATIDE ACETATE - Inxight Drugs, accessed July 22, 2025, https://drugs.ncats.io/drug/9959P4V12N
84. Parathyroid hormone (1-34) (human) - Tocris Bioscience, accessed July 22, 2025, https://www.tocris.com/products/parathyroid-hormone-1-34-human_3011
85. accessed January 1, 1970, https.ncbi.nlm.nih.gov/pmc/articles/PMC8037129/