Tralokinumab: A Comprehensive Monograph on a Targeted IL-13 Inhibitor for Atopic Dermatitis

Executive Summary

Tralokinumab is a first-in-class, fully human immunoglobulin G4 (IgG4​) monoclonal antibody that represents a significant advancement in the targeted treatment of atopic dermatitis (AD).[1] Marketed under the brand names Adbry® and Adtralza®, it is indicated for the treatment of moderate-to-severe AD in adult and adolescent patients (aged 12 years and older) who are candidates for systemic therapy.[3] The therapeutic action of tralokinumab is predicated on its high-affinity, specific binding to the interleukin-13 (IL-13) cytokine, a key driver of the Type 2 inflammation that underpins AD pathogenesis. By neutralizing IL-13, tralokinumab prevents its interaction with the IL-13Rα1/IL-4Rα receptor complex, thereby inhibiting the downstream signaling cascade responsible for skin barrier dysfunction, inflammation, and pruritus.[2]

The clinical efficacy and safety of tralokinumab were robustly established in the comprehensive ECZTRA Phase 3 clinical trial program. In pivotal monotherapy trials (ECZTRA 1 and 2), tralokinumab demonstrated statistically significant and clinically meaningful improvements in skin clearance, as measured by the Investigator's Global Assessment (IGA) score, and in disease severity, assessed by a 75% or greater improvement in the Eczema Area and Severity Index (EASI-75), compared to placebo at 16 weeks.[7] Efficacy was also demonstrated when used in combination with topical corticosteroids (ECZTRA 3) and in the adolescent population (ECZTRA 6), with long-term data from the ECZTEND extension study confirming durable responses and a consistent safety profile over several years of treatment.[5]

The safety profile of tralokinumab is well-characterized and generally favorable. The most frequently reported adverse events in clinical trials were upper respiratory tract infections (primarily the common cold), conjunctivitis, injection site reactions, and eosinophilia.[2] While most adverse events were mild to moderate in severity, warnings and precautions are in place for potential hypersensitivity reactions, the development of conjunctivitis or keratitis, and interactions with live vaccines. The development history of tralokinumab is notable for its focused success in dermatology following the discontinuation of its clinical program for severe asthma, where it failed to meet primary endpoints in Phase 3 trials.[11] This differential outcome has been instrumental in refining the scientific understanding of IL-13's dominant, non-redundant role in the pathophysiology of atopic dermatitis compared to other Type 2 inflammatory diseases. Tralokinumab thus offers a highly specific, targeted therapeutic option that has secured a distinct and important place in the evolving landscape of systemic treatments for atopic dermatitis.

Drug Identification and Physicochemical Characteristics

A precise and comprehensive identification of a therapeutic agent is fundamental to clinical pharmacology and regulatory science. This section details the nomenclature, unique identifiers, and structural properties of tralokinumab.

Nomenclature and Identifiers

Tralokinumab is identified by a range of names and registry numbers across various scientific and regulatory domains, ensuring its unambiguous characterization.

• Generic Names: The International Nonproprietary Name (INN) and United States Adopted Name (USAN) is tralokinumab. In the United States, the proper name is tralokinumab-ldrm.[13]
• Brand Names: The drug is marketed as Adbry® in the United States and as Adtralza® in the European Union, the United Kingdom, and Canada.[2]
• Synonyms and Development Codes: During its development, tralokinumab was known by the codes CAT-354, LP 0162, and LP-0162.[2]
• Registry Numbers:
• CAS Number: 1044515-88-9 [13]
• DrugBank ID: DB12169 [3]
• UNII ID: GK1LYB375A [13]
• KEGG ID: D09799 [15]
• ChEMBL ID: CHEMBL1743081 [13]
• Protein Data Bank (PDB) ID: 5L6Y (structure of the tralokinumab Fab fragment bound to IL-13) [13]
• Chemical Name: The formal chemical name is Immunoglobulin G4, anti-(human interleukin 13) (human monoclonal CAT-354 heavy chain), disulfide with human monoclonal CAT-354 light chain, dimer.[2]

Structural and Molecular Profile

Tralokinumab is a biologic agent produced using recombinant DNA technology in mouse myeloma cells.[22]

• Drug Type and Class: Tralokinumab is a biotech therapeutic, specifically a fully human monoclonal antibody (mAb) belonging to the Immunoglobulin G4 (IgG4​) subclass with a lambda light chain.[1] It is pharmacologically classified as an Interleukin-13 Antagonist or Inhibitor.[2]
• Chemical Formula: C6374​H9822​N1698​O2014​S44​.[3]
• Molecular Weight: The approximate average molecular weight is 147,000 Daltons (147 kDa), with a more precise calculated mass of 143,873.30 Da.[3] Such minor variations are typical for large glycoproteins.
• Protein Sequence: The primary structure, or amino acid sequence, defines the antibody's specificity and function.
• Heavy Chain: QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGLSWVRQAPGQGLEWMGWISANNGDTNYGQEFQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDSSSSWARWFFDLWGRGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK.[3]
• Light Chain: SYVLTQPPSVSVAPGKTARITCGGNIIGSKLVHWYQQKPGQAPVLVIYDDGDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDTGSDPVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS.[3]
• Disulfide Bridges: The complex three-dimensional structure of the antibody is stabilized by specific intramolecular and intermolecular disulfide bonds located at positions H22-H96, H149-H205, H263-H323, H369-H427, H228-H'228, H231-H'231, L22-L87, L136-L195, and H136-L213.[21]

The following table provides a consolidated summary of the key identification and property data for tralokinumab.

Table 1: Drug Identification and Key Properties

Property	Value
Generic Name	Tralokinumab, tralokinumab-ldrm
Brand Names	Adbry®, Adtralza®
DrugBank ID	DB12169
CAS Number	1044515-88-9
Drug Type	Biotech, Monoclonal Antibody
Antibody Class	Fully human IgG4​-lambda
Molecular Target	Interleukin-13 (IL-13)
Chemical Formula	C6374​H9822​N1698​O2014​S44​
Average Molecular Weight	~147 kDa

Pathophysiology of Atopic Dermatitis and the Role of Interleukin-13

To appreciate the therapeutic rationale for tralokinumab, it is essential to first understand the complex immunopathology of atopic dermatitis and the central role of its molecular target, interleukin-13.

Overview of Atopic Dermatitis Pathogenesis

Atopic dermatitis (AD) is a chronic, relapsing-remitting inflammatory skin disease characterized by intense pruritus (itching) and eczematous lesions.[2] Its pathogenesis is multifactorial, arising from a complex interplay between genetic susceptibility, epidermal barrier dysfunction, and profound immune dysregulation.[2] A defining feature of AD is the dominance of Type 2 inflammation, a response orchestrated primarily by T-helper 2 (Th2) cells and their signature cytokines, including IL-4, IL-5, and IL-13.[2] This immune polarization drives the key clinical features of the disease, creating a self-perpetuating cycle of barrier breakdown, inflammation, and itch.

Interleukin-13 as a Central Mediator

Among the Type 2 cytokines, interleukin-13 has emerged as a key, and arguably dominant, pathogenic driver in AD.[2] Evidence from lesional skin in patients with AD shows that IL-13 is the most abundant cytokine, and its levels directly correlate with disease severity.[2] IL-13 exerts its pleiotropic effects through several interconnected mechanisms:

• Impact on Skin Barrier Integrity: A healthy epidermal barrier is crucial for retaining moisture and preventing the entry of allergens, irritants, and pathogens. IL-13 actively dismantles this barrier. It directly suppresses the expression of critical structural proteins in keratinocytes, including filaggrin, loricrin, and involucrin, which are essential for the formation and integrity of the stratum corneum.[2] Furthermore, IL-13 impairs lipid metabolism in the skin by inhibiting fatty acid elongases, leading to a reduction in long-chain fatty acids like ceramides, which are vital components of the barrier's "mortar".[25] The resulting compromised barrier leads to increased transepidermal water loss (TEWL), causing the characteristic dryness (xerosis) of AD, and allows for deeper penetration of environmental triggers, further fueling the inflammatory response.
• Pro-inflammatory Signaling Cascade: IL-13 is a potent orchestrator of the inflammatory milieu in AD. It stimulates keratinocytes to produce chemokines, such as CCL17 (TARC) and CCL22, which act as powerful attractants for additional Th2 cells and other inflammatory cells like eosinophils into the skin.[3] This influx of immune cells leads to the release of more IL-13, creating a vicious positive feedback loop that sustains chronic inflammation.[26] IL-13 also promotes the production of Immunoglobulin E (IgE) by B-cells, a hallmark of atopic diseases, which sensitizes mast cells and contributes to the allergic phenotype.[24]
• Induction of Pruritus: The intense and debilitating itch of AD is not merely a symptom but a central feature that drives the itch-scratch cycle, leading to further skin damage and inflammation. IL-13 contributes directly to pruritus by acting on sensory neurons in the skin, thereby lowering the itch threshold.[24]
• Microbial Dysbiosis: The skin of patients with AD is characterized by a loss of microbial diversity and a marked propensity for colonization by the pathogenic bacterium Staphylococcus aureus.[25] IL-13 contributes to this dysbiosis by suppressing the production of endogenous antimicrobial peptides by keratinocytes.[2] This impaired innate immune defense allows S. aureus to proliferate, and toxins produced by the bacteria can act as superantigens, further amplifying the underlying Type 2 inflammation and exacerbating the disease.[29]

The starkly different clinical outcomes of tralokinumab in atopic dermatitis (highly effective) and severe asthma (ineffective) provide compelling evidence for the "IL-13 dominance" hypothesis in the skin. While both AD and asthma are considered Type 2 inflammatory diseases where IL-13 plays a role, the failure of specific IL-13 blockade in large-scale asthma trials suggests a more complex and redundant pathophysiology in the airways.[11] In asthma, other cytokines such as IL-4 and IL-5, or entirely different inflammatory pathways, may play more significant or compensatory roles, rendering the inhibition of IL-13 alone insufficient to control the disease. In contrast, the profound clinical success of tralokinumab in AD underscores that IL-13's role in the skin is more central, less redundant, and absolutely critical to the disease process. This tissue-specific importance of IL-13 provides a clear biological rationale for the development and use of a highly targeted IL-13 inhibitor as a therapeutic strategy for atopic dermatitis.

Mechanism of Action and Pharmacodynamics

The therapeutic effect of tralokinumab is derived from its precise molecular interaction with IL-13 and the subsequent downstream modulation of the biological pathways that drive atopic dermatitis.

Molecular Target and Binding Mechanism

Tralokinumab is a fully human IgG4​ monoclonal antibody engineered to bind with high affinity and specificity to soluble human interleukin-13.[2] The mechanism of action is one of direct neutralization. The binding site (epitope) for tralokinumab on the IL-13 cytokine sterically overlaps with the binding sites for the IL-13 receptors.[31] This physical blockade prevents IL-13 from engaging with its cell-surface receptors, thereby inhibiting the initiation of its biological signaling cascade.

Tralokinumab effectively blocks the interaction of IL-13 with two key receptor complexes [3]:

1. The IL-13Rα1/IL-4Rα Heterodimer: This is the primary signaling receptor complex for IL-13. The signaling process is initiated when IL-13 binds to the IL-13 receptor alpha 1 (IL-13Rα1) subunit. This binding event then recruits the IL-4 receptor alpha (IL-4Rα) subunit to form a functional heterodimeric complex. This assembly activates intracellular Janus kinases (JAKs), which in turn phosphorylate and activate Signal Transducer and Activator of Transcription (STAT) proteins, primarily STAT6. The activated STAT6 translocates to the nucleus and promotes the transcription of genes responsible for the inflammatory and pathological features of AD.[3] By preventing the initial binding of IL-13 to IL-13Rα1, tralokinumab completely abrogates this entire downstream signaling pathway.
2. The IL-13Rα2 Receptor: This is a high-affinity receptor for IL-13 that does not appear to directly mediate signal transduction and is often considered a "decoy" receptor that contributes to the endogenous regulation of IL-13 by sequestering it.[24] Tralokinumab also prevents free IL-13 from binding to this receptor.

Detailed biochemical studies have revealed a critical nuance in these receptor interactions. While tralokinumab is highly effective at neutralizing free, circulating IL-13 and preventing its binding to both receptor types, it is unable to displace IL-13 that is already bound to the high-affinity IL-13Rα2 decoy receptor.[31] This distinction frames the drug's mechanism as primarily prophylactic—it acts as a continuous "sink" or "shield" against newly produced IL-13, preventing it from reaching its signaling receptor. This is in contrast to a mechanism that could actively reverse established receptor-ligand complexes. This molecular behavior provides a strong rationale for the clinical dosing strategy of tralokinumab. An initial high loading dose (e.g., 600 mg in adults) is required to rapidly achieve therapeutic concentrations sufficient to neutralize the existing pool of circulating IL-13. Subsequently, a consistent maintenance dose (e.g., 300 mg every two weeks) is necessary to maintain this neutralizing capacity and continuously intercept ongoing IL-13 production.[3] This also helps explain the observed clinical timeline, where maximal therapeutic effects are typically assessed at 16 weeks. While some early improvements in symptoms like itch may occur, it takes time for the established cutaneous inflammation and barrier defects to resolve once the continuous pro-inflammatory signaling from IL-13 is effectively and persistently blocked.

Pharmacodynamic Effects and Biomarker Modulation

The neutralization of IL-13 by tralokinumab leads to measurable changes in a host of biological markers associated with AD, confirming its on-target activity and providing insight into its clinical effects.

• Systemic Biomarkers: Treatment with tralokinumab results in a significant and rapid reduction of key serum biomarkers of Type 2 inflammation. By week 16 of treatment, patients receiving tralokinumab show a statistically significant decrease from baseline in the levels of CCL17 (also known as TARC), periostin, and total serum IgE when compared to placebo.[2] Concentrations of IL-22, a cytokine associated with epidermal hyperplasia and Th22 pathways, are also reduced.[3]
• Cutaneous (Skin) Biomarkers: The effects of tralokinumab are profound at the tissue level. Analysis of skin biopsies from treated patients reveals a normalization of the gene expression profile in lesional skin, shifting it progressively toward that of non-lesional or healthy skin.[35] This molecular reversal includes:
• Downregulation of Inflammatory Genes: A significant reduction in the expression of genes associated with Th2 inflammation (e.g., CCL17, CCL26), as well as genes from other inflammatory pathways like Th1 (IFNG) and Th17/Th22 (IL22, S100A proteins) that are upregulated in chronic AD lesions.[35]
• Upregulation of Barrier-Related Genes: A corresponding increase in the expression of genes crucial for epidermal differentiation and barrier function, such as those encoding for loricrin (LOR) and claudin-1 (CLDN1).[2]
• Histological Improvement: These molecular changes translate into visible improvements in skin pathology, including a reduction in epidermal thickness (acanthosis) and decreased expression of cellular proliferation markers like Keratin 16 and Ki-67.[3]
• Microbiome Effects: By restoring skin barrier integrity and potentially enhancing the production of antimicrobial peptides, tralokinumab treatment leads to a rebalancing of the skin microbiome. Clinical studies have shown a reduction in the colonization of lesional skin by S. aureus, which is associated with fewer skin infections requiring systemic treatment and a lower frequency of eczema herpeticum compared to placebo.[29]

Pharmacokinetic Profile

The pharmacokinetic (PK) profile of tralokinumab describes its absorption, distribution, metabolism, and elimination (ADME), which collectively determine the dosing regimen required to maintain therapeutic concentrations.

Absorption

Tralokinumab is administered via subcutaneous injection.[3] Following subcutaneous administration, it is absorbed into the systemic circulation with an estimated absolute bioavailability of 76%.[2] The median time to reach maximum serum concentration (

Tmax​) ranges from 5 to 8 days after a single dose.[2] With the recommended dosing regimen of an initial loading dose followed by maintenance doses every two weeks, steady-state serum concentrations are achieved by week 16 of treatment.[2]

Distribution

The estimated total volume of distribution (Vd​) for tralokinumab is approximately 4.2 L.[2] This relatively small volume of distribution indicates that the drug is primarily confined to the vascular and interstitial compartments, which is typical for large protein molecules like monoclonal antibodies.

Metabolism and Elimination

As a fully human protein, tralokinumab is not metabolized by hepatic cytochrome P450 (CYP) enzymes. Instead, it is expected to be degraded through non-saturable proteolytic pathways into smaller peptides and individual amino acids, which are then recycled into the body's endogenous amino acid pool.[2] This catabolic process is the standard elimination pathway for endogenous immunoglobulins. The elimination half-life (

t1/2​) of tralokinumab is approximately 22 days, which is consistent with the typical half-life of human IgG4​ antibodies that target soluble cytokines.[2] The systemic clearance (CL) was estimated from population pharmacokinetic analyses to be 0.149 L/day.[2]

Population Pharmacokinetics and Covariate Analysis

A comprehensive population PK analysis, incorporating data from 2,561 subjects across 10 clinical trials (including healthy individuals and patients with AD or asthma), confirmed that the pharmacokinetics of tralokinumab are well-described by a two-compartment model with first-order absorption and linear elimination.[28] The analysis investigated the influence of various patient characteristics (covariates) on drug exposure.

The most significant covariate identified was body weight. The analysis demonstrated an inverse relationship between body weight and tralokinumab exposure, meaning that individuals with higher body weight achieve lower serum concentrations of the drug.[28] Other covariates, including age, sex, race, ethnicity, disease type (AD vs. asthma), and mild-to-moderate renal or hepatic impairment, were found to have no clinically relevant impact on tralokinumab exposure.[28]

This key finding regarding body weight has direct clinical implications and informs the drug's dosing recommendations. The approved labeling allows for clinicians to consider reducing the maintenance dosing frequency from 300 mg every two weeks to 300 mg every four weeks, but only for patients weighing less than 100 kg who have already achieved clear or almost clear skin after 16 weeks of treatment.[28] This recommendation is a direct application of the PK data. For a patient with a higher body weight (>100 kg), the combination of inherently lower drug exposure due to weight and a less frequent dosing schedule could risk dropping trough concentrations below the therapeutic threshold, potentially leading to a loss of efficacy. The weight-based dose adjustment guidance is therefore a critical measure to mitigate this risk and personalize therapy to maintain efficacy across different patient populations, representing a sophisticated application of pharmacokinetic principles in clinical practice.

The following table summarizes the key pharmacokinetic parameters for tralokinumab in adult patients.

Table 2: Summary of Pharmacokinetic Parameters in Adults

Parameter	Value
Absolute Bioavailability	76%
Time to Max. Concentration (Tmax​)	5-8 days
Volume of Distribution (Vd​)	~4.2 L
Elimination Half-Life (t1/2​)	~22 days
Clearance (CL)	~0.149 L/day
Time to Steady State	~16 weeks

Clinical Efficacy in Atopic Dermatitis

The approval of tralokinumab for moderate-to-severe atopic dermatitis is supported by a robust body of evidence from a series of large, well-controlled Phase 3 clinical trials, collectively known as the ECZTRA program. These trials systematically evaluated the efficacy of tralokinumab as both a monotherapy and in combination with topical corticosteroids across adult and adolescent populations.

Pivotal Monotherapy Trials (ECZTRA 1 & ECZTRA 2)

The cornerstone of the clinical program, ECZTRA 1 and ECZTRA 2, were two identical, 52-week, randomized, double-blind, placebo-controlled, multinational trials designed to assess the efficacy and safety of tralokinumab monotherapy in adults with moderate-to-severe AD who had an inadequate response to topical treatments.[7] In each trial, patients were randomized in a 3:1 ratio to receive either subcutaneous tralokinumab 300 mg every two weeks (Q2W) or a matching placebo.[7]

The co-primary endpoints, assessed at Week 16, were:

1. An Investigator's Global Assessment (IGA) score of 0 (clear) or 1 (almost clear).
2. At least a 75% improvement from baseline in the Eczema Area and Severity Index (EASI-75).

At Week 16, tralokinumab demonstrated statistically significant superiority over placebo for both primary endpoints in both trials [7]:

• In ECZTRA 1, 15.8% of patients in the tralokinumab group achieved an IGA score of 0/1 compared to 7.1% in the placebo group (p=0.002). For EASI-75, the response rates were 25.0% for tralokinumab versus 12.7% for placebo (p<0.001).
• In ECZTRA 2, 22.2% of tralokinumab-treated patients achieved an IGA of 0/1 versus 10.9% for placebo (p<0.001). EASI-75 was achieved by 33.2% of patients on tralokinumab compared to 11.4% on placebo (p<0.001).

Beyond the primary endpoints, the trials also demonstrated early and sustained improvements in key patient-reported outcomes (PROs). Significant reductions in pruritus (itch), sleep interference, and improvements in overall quality of life, as measured by the Dermatology Life Quality Index (DLQI), were observed with tralokinumab compared to placebo from the first post-baseline measurements.[7]

For patients who achieved a clinical response at Week 16, a re-randomization phase demonstrated the durability of the treatment effect. The majority of these responders who continued on tralokinumab (either Q2W or every four weeks) maintained their response at Week 52, confirming the long-term efficacy of the therapy.[7]

Combination Therapy Trial (ECZTRA 3)

To evaluate tralokinumab in a setting more reflective of real-world clinical practice, the ECZTRA 3 trial was conducted. This 32-week, randomized, double-blind, placebo-controlled study assessed the efficacy of tralokinumab 300 mg Q2W when used concomitantly with topical corticosteroids (TCS) as needed in adults with moderate-to-severe AD.[8]

The results at Week 16 again showed significant superiority for the tralokinumab arm:

• IGA 0/1: 38.9% of patients in the tralokinumab + TCS group achieved this endpoint, compared to 26.2% in the placebo + TCS group (p=0.015).[8]
• EASI-75: 56.0% of patients receiving tralokinumab + TCS achieved EASI-75, versus 35.7% for placebo + TCS (p<0.001).[8]

A critical finding from ECZTRA 3 was the demonstration of a significant corticosteroid-sparing effect. Patients in the tralokinumab group required substantially less TCS to control their disease compared to those in the placebo group, highlighting an important clinical benefit in reducing the cumulative exposure to topical steroids.[8] The study also provided evidence that some patients who showed only a partial response at Week 16 could continue to improve and achieve a full response by Week 32 with continued treatment, suggesting that a longer duration of therapy may be necessary for a subset of patients to reach their maximal benefit.[8]

Adolescent Population Trial (ECZTRA 6)

The ECZTRA 6 trial was a pivotal Phase 3 study designed to establish the efficacy and safety of tralokinumab in adolescent patients aged 12 to 17 with moderate-to-severe AD.[5] The positive results from this trial were instrumental in securing regulatory approval for this younger population.

At Week 16, tralokinumab demonstrated significant improvements over placebo across all key endpoints:

• IGA 0/1: 21% of adolescents treated with tralokinumab achieved clear or almost clear skin, compared to only 4% in the placebo group.[5]
• EASI-75: 29% of patients in the tralokinumab arm achieved a 75% improvement in disease severity, versus 6% in the placebo arm.[5]
• Pruritus Reduction: A clinically meaningful reduction in itch was reported by 23% of adolescents on tralokinumab, compared to just 3% on placebo.[5]

Long-Term Extension Data (ECZTEND)

The ECZTEND trial is an ongoing, open-label extension study for patients who have completed previous tralokinumab trials, designed to assess long-term efficacy and safety.[9] Data from up to six years of continuous treatment have shown that tralokinumab provides robust and durable efficacy. Over a three-year period, approximately seven out of ten patients maintained no-to-mild disease with minimal fluctuation in disease activity.[9] Importantly, these long-term data have not identified any new safety signals, confirming the favorable and consistent safety profile of tralokinumab over extended periods of use.[9]

Real-World Evidence and Special Populations

While pivotal trials are essential for regulatory approval, their strict inclusion/exclusion criteria often limit generalizability. A retrospective, dual-center study provided valuable insights into the use of tralokinumab in 27 patients classified as "special populations," including the elderly and those with significant comorbidities such as oncologic, neurologic, or cardiovascular diseases.[41] The study found that over a 24-week period, tralokinumab was both effective and safe in this complex patient cohort, with significant improvements in EASI and pruritus scores and no new adverse events reported. This provides crucial reassurance for the use of tralokinumab in real-world patients who are typically excluded from clinical trials.[41]

The following table summarizes the primary efficacy outcomes from the key Phase 3 trials that established the clinical benefit of tralokinumab in atopic dermatitis.

Table 3: Summary of Efficacy Outcomes from Pivotal Phase 3 Atopic Dermatitis Trials (ECZTRA 1, 2, 3, & 6)

Trial	Patient Population	Treatment Arm	N	IGA 0/1 at Week 16 (%)	EASI-75 at Week 16 (%)
ECZTRA 1	Adults (Monotherapy)	Tralokinumab 300 mg Q2W	601	15.8%	25.0%
		Placebo	198	7.1%	12.7%
ECZTRA 2	Adults (Monotherapy)	Tralokinumab 300 mg Q2W	596	22.2%	33.2%
		Placebo	198	10.9%	11.4%
ECZTRA 3	Adults (+ TCS)	Tralokinumab 300 mg Q2W	253	38.9%	56.0%
		Placebo	127	26.2%	35.7%
ECZTRA 6	Adolescents (12-17 yrs)	Tralokinumab	195	21%	29%
		Placebo	94	4%	6%

Development History and Other Investigated Indications

The clinical development path of tralokinumab is a compelling narrative of strategic focus and scientific refinement. Its journey from a broad-spectrum anti-inflammatory candidate to a highly successful dermatologic therapy involved a pivotal shift following disappointing results in other indications, most notably severe asthma.

Discovery and Licensing

Tralokinumab, originally designated CAT-354, was discovered by scientists at Cambridge Antibody Technology (later part of MedImmune/AstraZeneca) utilizing advanced Ribosome Display technology for protein optimization.[15] Initial development was conducted by MedImmune, the global biologics research and development arm of AstraZeneca.[2] Recognizing the compound's potential and aligning with corporate strategies, AstraZeneca made a pivotal decision in 2016. They granted LEO Pharma, a company with a deep focus on dermatology, an exclusive global license to develop and commercialize tralokinumab for atopic dermatitis and all future skin disease indications.[2] This strategic partnership allowed LEO Pharma to leverage its dermatological expertise to successfully navigate the Phase 3 program and bring the drug to market for AD, while AstraZeneca continued to investigate its potential in respiratory diseases.

Discontinuation of the Asthma Program

Contemporaneous with its development in dermatology, tralokinumab was extensively investigated as a treatment for severe, uncontrolled asthma, based on the well-established role of IL-13 in airway inflammation, mucus hypersecretion, and airway hyperresponsiveness.[18] Early Phase 2 trials showed some encouraging signals, such as improvements in lung function (FEV1), but failed to demonstrate a significant reduction in the annual asthma exacerbation rate (AAER) or improvements in overall asthma control measures.[44]

Despite these mixed early results, AstraZeneca advanced tralokinumab into a large-scale Phase 3 program for asthma, which ultimately failed to meet its primary objectives across multiple large trials [11]:

• STRATOS 1: This trial evaluated tralokinumab in a broad population of patients with severe, uncontrolled asthma. It failed to meet its primary endpoint of a statistically significant reduction in the AAER compared to placebo.[11]
• STRATOS 2: Based on a sub-analysis of STRATOS 1 that suggested a potential benefit in patients with elevated Fractional exhaled Nitric Oxide (FeNO)—a biomarker of Type 2 airway inflammation—this trial was designed to specifically test that hypothesis. However, STRATOS 2 also failed to demonstrate a significant reduction in AAER in this biomarker-selected population.[11]
• TROPOS: This trial was designed to assess a different clinical benefit: the potential for tralokinumab to reduce the need for maintenance oral corticosteroids (OCS), a key goal in managing severe asthma. The trial failed to meet its primary endpoint, showing no significant OCS-sparing effect for tralokinumab compared to placebo.[11]

Given the consistent lack of efficacy across these three large, well-designed Phase 3 trials, AstraZeneca announced the discontinuation of the entire tralokinumab development program for asthma in late 2017.[12] This outcome, while disappointing for the respiratory field, was scientifically informative, suggesting that specific IL-13 inhibition alone is not sufficient to control the complex and heterogeneous pathology of severe asthma.

Other Investigated Indications

Beyond dermatology and asthma, tralokinumab was explored in several other inflammatory conditions, but these programs did not advance past mid-stage development and were ultimately discontinued.[48] These included:

• Idiopathic Pulmonary Fibrosis (IPF): Investigated in a Phase 2 trial (NCT01629667).[18]
• Alopecia Areata: A Phase 2 pilot study (NCT02684097) was completed.[13]
• Ulcerative Colitis: Explored in Phase 2 development.[13]

The following table provides a summary of the development status of tralokinumab in these non-dermatological indications.

Table 4: Overview of Tralokinumab Development in Non-Dermatological Indications

Indication	Highest Phase Reached	Key Trial(s)	Outcome / Status
Severe Asthma	Phase 3	STRATOS 1, STRATOS 2, TROPOS	Failed to meet primary endpoints; Development Discontinued
Idiopathic Pulmonary Fibrosis	Phase 2	NCT01629667	Development Discontinued
Alopecia Areata	Phase 2	NCT02684097	Development Discontinued
Ulcerative Colitis	Phase 2	Not specified	Development Discontinued

Safety and Tolerability Profile

The safety and tolerability of tralokinumab have been extensively evaluated in a large clinical development program involving over 1,900 patients with atopic dermatitis, with long-term data extending up to several years.[33] The overall safety profile is well-characterized and considered favorable.

Overview from Clinical Trials

In the initial 16-week, placebo-controlled periods of the pivotal Phase 3 trials, the overall frequency and severity of adverse events (AEs) were comparable between the tralokinumab and placebo groups.[7] This favorable safety profile was maintained during long-term treatment for up to 52 weeks in monotherapy studies and 32 weeks in combination with TCS.[10] Most adverse events reported were mild or moderate in severity, and the rate of discontinuation due to AEs was low and similar to placebo.[8]

Adverse Reactions

The following table summarizes the adverse reactions reported in clinical trials, categorized by MedDRA System Organ Class and frequency. The frequencies are derived from the pooled data of five AD clinical trials during the initial 16-week treatment period.

Table 5: Tabulated Summary of Adverse Reactions from Pooled Clinical Trials (by Frequency)

MedDRA System Organ Class	Frequency	Adverse Reaction
Infections and infestations	Very common (≥1/10)	Upper respiratory tract infections (23.4%)¹
Eye disorders	Common (≥1/100 to <1/10)	Conjunctivitis (5.4%)
		Allergic conjunctivitis (2.0%)
Blood and lymphatic system disorders	Common (≥1/100 to <1/10)	Eosinophilia (1.3%)
General disorders and administration site conditions	Common (≥1/100 to <1/10)	Injection site reactions (7.2%)
Eye disorders	Uncommon (≥1/1,000 to <1/100)	Keratitis (0.5%)

¹ Mainly reported as common cold.

[10]

Warnings and Precautions

Based on the clinical trial data, several warnings and precautions have been established to guide the safe use of tralokinumab.

• Hypersensitivity Reactions: As with all biologic therapies, there is a risk of hypersensitivity reactions. Serious reactions, including anaphylaxis and angioedema, have been reported with the use of tralokinumab. If a systemic hypersensitivity reaction occurs, treatment must be discontinued immediately, and appropriate medical therapy should be initiated.[4]
• Conjunctivitis and Keratitis: Ocular events are an adverse effect of special interest with IL-13 pathway inhibitors. In clinical trials, conjunctivitis occurred more frequently in patients treated with tralokinumab (5.4%) compared to placebo (1.9%).[10] Most cases were mild to moderate in severity and resolved during the treatment period. Keratitis (inflammation of the cornea) was reported uncommonly (0.5%). Patients should be advised to report any new onset or worsening eye symptoms, such as redness, itching, pain, or vision changes, to their healthcare provider. If conjunctivitis develops and does not resolve with standard treatment, an ophthalmological examination is recommended.[10] This is considered an important potential risk in the drug's risk management plan.[54]
• Parasitic (Helminth) Infections: The IL-13 pathway is known to be involved in the immune response against helminth (parasitic worm) infections. It is unknown if tralokinumab will influence this response. Therefore, patients with known pre-existing helminth infections should be treated prior to starting tralokinumab. If a patient becomes infected during treatment and does not respond to anti-helminth therapy, tralokinumab should be discontinued until the infection resolves.[4]
• Vaccinations: The use of live or live-attenuated vaccines is not recommended concurrently with tralokinumab treatment, as the drug may alter the immune response and the safety and efficacy of this combination have not been established.[10] Patients should be brought up to date with all age-appropriate immunizations according to current guidelines before initiating therapy. Clinical studies have shown that tralokinumab does not negatively impact the immune response to non-live vaccines, such as the tetanus and meningococcal vaccines.[2]

Use in Special Populations

• Pregnancy: There is limited clinical data on the use of tralokinumab in pregnant women. Animal reproduction studies did not indicate harmful effects; however, substantial placental transfer of the antibody was observed in cynomolgus monkeys.[20] As a precautionary measure, the use of tralokinumab during pregnancy is generally avoided.[10] A pregnancy exposure registry has been established to monitor maternal and fetal outcomes in women exposed to tralokinumab during pregnancy.[51]
• Lactation: It is not known whether tralokinumab is excreted in human milk or absorbed systemically by a breastfed infant. Because it is a large protein molecule, the amount in milk is expected to be very low, and it would likely be degraded in the infant's gastrointestinal tract.[20] The decision to use tralokinumab during breastfeeding should be made by weighing the potential benefits for the mother against the potential risks to the infant.[20]
• Pediatric Use: The safety and efficacy of tralokinumab have been established in adolescents aged 12 to 17 years based on the results of the ECZTRA 6 trial.[4] Safety and efficacy have not been established in children younger than 12 years of age.[36]
• Geriatric Use: Clinical studies have included elderly patients, and no geriatric-specific safety concerns have been identified that would limit the usefulness of tralokinumab in this population.[36]

Drug-Drug Interactions

Tralokinumab is not metabolized by CYP450 enzymes, and therefore, clinically relevant pharmacokinetic interactions with drugs that are substrates, inhibitors, or inducers of these enzymes are not expected.[57] The primary interaction concerns are pharmacodynamic:

• Live Vaccines: As noted above, concurrent use should be avoided.[14]
• Other Biologic Therapies: The concurrent use of tralokinumab with other therapeutic biologics, particularly those that are immunosuppressive, is generally not recommended as the combined effects on the immune system have not been studied.[58]

Dosage, Administration, and Patient Guidance

Proper dosage, administration technique, and patient education are critical for achieving optimal therapeutic outcomes and ensuring the safe use of tralokinumab.

Dosage Regimens

The recommended dosage of tralokinumab varies by age group. It can be used with or without concomitant topical corticosteroids.[4]

• Adults (18 years of age and older):
• Initial Dose: A loading dose of 600 mg, administered as four 150 mg injections or two 300 mg injections.[3]
• Maintenance Dose: 300 mg administered every other week (Q2W) via subcutaneous injection.[3]
• Adolescents (12 to 17 years of age):
• Initial Dose: A loading dose of 300 mg, administered as two 150 mg injections.[4]
• Maintenance Dose: 150 mg administered every other week (Q2W) via subcutaneous injection.[4]
• Dose Adjustment Consideration: For adult patients weighing less than 100 kg who achieve clear or almost clear skin (IGA 0/1) after 16 weeks of treatment, the prescribing clinician may consider reducing the maintenance dosing frequency to 300 mg every four weeks (Q4W).[22]

Dosage Forms and Strengths

Tralokinumab is supplied as a sterile, preservative-free, clear to opalescent, colorless to pale yellow solution for subcutaneous injection in two presentations:

• 150 mg/mL single-dose prefilled syringe: For use in adults and adolescents.[4]
• 300 mg/2mL single-dose autoinjector: For use in adults only.[4]

Administration Instructions

Patients may self-administer tralokinumab after receiving proper training from a healthcare provider on subcutaneous injection technique.[22]

• Preparation: The prefilled syringe or autoinjector should be removed from the refrigerator and allowed to warm to room temperature for 30-45 minutes before injection. The device should not be warmed by any other means (e.g., microwave, hot water) and should not be shaken.[36] The solution should be visually inspected for particulate matter or discoloration before use.[36]
• Injection Sites: The recommended injection sites are the thigh, abdomen (avoiding a 2-inch radius around the navel), or the upper arm (if administered by a caregiver).[36]
• Technique: Injection sites should be rotated with each dose to avoid repeated injections into the same location.[10] Tralokinumab should not be injected into skin that is tender, damaged, bruised, erythematous, or scarred.[22] Each syringe or autoinjector is for single use only and should be disposed of in an FDA-approved sharps container after use.[51]

Patient Counseling and Storage

• Storage: Tralokinumab should be stored in a refrigerator at 2°C to 8°C (36°F to 46°F) in its original carton to protect it from light. It must not be frozen.[51]
• Room Temperature Storage: If necessary, prefilled syringes or autoinjectors may be kept at room temperature up to 30°C (86°F) for a maximum of 14 days in the original carton. If a device is stored at room temperature, the date of removal from the refrigerator should be noted. If not used within 14 days, it must be discarded and should not be placed back in the refrigerator.[51]
• Patient Counseling: Patients should be counseled on the signs and symptoms of a serious hypersensitivity reaction (e.g., breathing problems, swelling of the face/tongue, hives, dizziness) and instructed to seek immediate emergency medical help if they occur. Patients should also be advised to report any new or worsening eye problems to their healthcare provider.[51]

Regulatory and Market Landscape

Tralokinumab has successfully navigated the rigorous regulatory pathways in major global markets, establishing its role as a key therapeutic option for moderate-to-severe atopic dermatitis.

Key Regulatory Approvals

• European Union (EMA): Tralokinumab received its first global approval in the EU on June 17, 2021, under the brand name Adtralza®. It was initially indicated for the treatment of moderate-to-severe AD in adults who are candidates for systemic therapy. The indication was subsequently expanded to include adolescents aged 12 and older.[2]
• United Kingdom (MHRA): Approval was granted in June 2021, concurrent with the EU decision.[15]
• United States (FDA): The FDA approved tralokinumab on December 27, 2021, under the brand name Adbry® (tralokinumab-ldrm). The initial indication was for adults with moderate-to-severe AD whose disease is not adequately controlled with topical prescription therapies or when those therapies are not advisable.[4] In December 2023, the FDA expanded the approval to include adolescent patients aged 12 to 17.[5]
• Canada (Health Canada): Health Canada approved Adtralza® on October 13, 2021.[3]

Formulary and Treatment Guidelines

Tralokinumab is positioned as a systemic therapy for patients with more severe disease. Current treatment guidelines, such as those from the American Academy of Dermatology (AAD), generally recommend a stepwise approach, with topical agents (e.g., corticosteroids, calcineurin inhibitors) being the first line of treatment for AD.[53] Systemic therapies like tralokinumab are considered for patients whose disease is not adequately controlled by topical treatments or for whom topical therapies are not advisable.

Access to tralokinumab is often governed by prior authorization criteria from insurance payers and national health systems. These criteria typically require documentation of moderate-to-severe disease and evidence of failure, intolerance, or contraindication to an adequate trial of one or more topical therapies.[58] In some cases, a trial of conventional systemic immunosuppressants (e.g., cyclosporine, methotrexate) may also be required before a biologic is approved.[64]

Place in Therapy and Concluding Analysis

The approval of tralokinumab marked a significant milestone, adding a new mechanism of action to the therapeutic armamentarium for atopic dermatitis. It joined a landscape that includes the dual IL-4/IL-13 inhibitor, dupilumab, and several oral Janus kinase (JAK) inhibitors.[65] The availability of these agents with distinct mechanisms creates a new therapeutic paradigm based on the specificity versus the breadth of immune modulation.

Tralokinumab's highly specific targeting of only the IL-13 cytokine represents a "rifle shot" approach to treatment. This strategy is founded on the extensive evidence supporting IL-13 as the dominant pathogenic driver in the skin of most AD patients. This high degree of specificity may offer a theoretical advantage by leaving other cytokine pathways, such as those mediated solely by IL-4, untouched, which could potentially translate to a different long-term safety and tolerability profile.

In contrast, dupilumab acts as a "dual inhibitor" by blocking the shared IL-4Rα subunit, thereby inhibiting signaling from both IL-4 and IL-13.[24] This broader blockade of the Type 2 axis may offer greater efficacy in patients whose disease is driven by contributions from both cytokines. JAK inhibitors offer the broadest mechanism, acting intracellularly to inhibit signaling from a wide array of cytokines involved in inflammation and immunity.

This diversity of mechanisms shifts the clinical decision-making process from simply determining if a patient needs systemic therapy to selecting which systemic therapy is most appropriate for an individual patient. The existence of a specific IL-13 inhibitor like tralokinumab propels the field toward a more personalized or precision-medicine approach. Future research will likely focus on identifying predictive biomarkers that can help stratify patients based on their specific disease endotype (e.g., an "IL-13-dominant" profile vs. an "IL-4/IL-13 co-dominant" profile). Tralokinumab's position in the market is therefore defined by its unique, highly targeted mechanism, offering a valuable option for patients with moderate-to-severe atopic dermatitis, particularly for those in whom specific IL-13 blockade is sufficient for disease control or for whom the side-effect profiles of broader-acting agents are a concern.

Conclusion

Tralokinumab is a precisely engineered, fully human monoclonal antibody that has been rigorously validated as an effective and well-tolerated therapy for moderate-to-severe atopic dermatitis in adults and adolescents. As the first-in-class biologic that specifically neutralizes interleukin-13, its mechanism of action is directly aimed at a central driver of the inflammation, barrier dysfunction, and pruritus that characterize the disease.

The comprehensive ECZTRA clinical trial program has unequivocally demonstrated its ability to improve skin lesions, reduce itch, and enhance quality of life, with a durable response and a consistent safety profile observed over long-term use. The most common adverse events, including upper respiratory tract infections and conjunctivitis, are generally manageable. The drug's development journey, marked by its success in dermatology following its discontinuation for severe asthma, has provided invaluable scientific insights, solidifying the understanding of IL-13's dominant pathogenic role in the skin.

In a rapidly evolving therapeutic landscape, tralokinumab offers a distinct, highly targeted approach. Its specificity provides a valuable alternative to broader-acting agents, paving the way for a more nuanced and potentially personalized approach to managing atopic dermatitis. By effectively interrupting a key pathway in the disease's pathophysiology, tralokinumab stands as a significant and welcome addition to the armamentarium of treatments available to patients suffering from this chronic and burdensome condition.

Works cited

1. 761180Orig1s000 - accessdata.fda.gov, accessed September 1, 2025, https://www.accessdata.fda.gov/drugsatfda_docs/nda/2022/761180Orig1s000IntegratedR.pdf
2. Tralokinumab: First Approval - PMC, accessed September 1, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC8519819/
3. Tralokinumab: Uses, Interactions, Mechanism of Action | DrugBank Online, accessed September 1, 2025, https://go.drugbank.com/drugs/DB12169
4. Adbry (tralokinumab-ldrm) C23078-A - Molina Healthcare, accessed September 1, 2025, https://www.molinahealthcare.com/-/media/Molina/PublicWebsite/PDF/Providers/common/pa-criteria/Adbry-tralokinumab.pdf
5. FDA Approves Tralokinumab for Adolescents With Atopic Dermatitis, accessed September 1, 2025, https://www.ajmc.com/view/fda-approves-tralokinumab-for-adolescents-with-atopic-dermatitis
6. pmc.ncbi.nlm.nih.gov, accessed September 1, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC8519819/#:~:text=Tralokinumab%2C%20a%20fully%20human%20IgG4,IL%2D13%20%5B8%5D.
7. Tralokinumab for moderate-to-severe atopic dermatitis: results from ..., accessed September 1, 2025, https://pubmed.ncbi.nlm.nih.gov/33000465/
8. Tralokinumab: First Approval - PMC, accessed September 1, 2025, https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8519819/
9. Tralokinumab in the Era of Disruption in Atopic Dermatitis - European Medical Journal, accessed September 1, 2025, https://www.emjreviews.com/dermatology/article/tralokinumab-in-the-era-of-disruption-in-atopic-dermatitis-j030124/
10. Adtralza 150 mg solution for injection in pre-filled syringe - Summary of Product Characteristics (SmPC) - (emc) | 12725, accessed September 1, 2025, https://www.medicines.org.uk/emc/product/12725/smpc
11. Double disappointment for AstraZeneca lung drug tralokinumab - Fierce Biotech, accessed September 1, 2025, https://www.fiercebiotech.com/biotech/double-disappointment-for-astrazeneca-lung-drug-tralokinumab
12. AstraZeneca Drops Phase III Asthma Drug as Company Posts Disappointing 2017 Financials - BioSpace, accessed September 1, 2025, https://www.biospace.com/unique-astrazeneca-drops-phase-iii-asthma-drug-as-company-posts-disappointing-2017-financials
13. Tralokinumab - PharmaKB, accessed September 1, 2025, https://www.pharmakb.com/drug-report/tralokinumab
14. Adbry (tralokinumab) dosing, indications, interactions, adverse effects, and more, accessed September 1, 2025, https://reference.medscape.com/drug/adbry-tralokinumab-4000121
15. Tralokinumab - Wikipedia, accessed September 1, 2025, https://en.wikipedia.org/wiki/Tralokinumab
16. en.wikipedia.org, accessed September 1, 2025, https://en.wikipedia.org/wiki/Tralokinumab#:~:text=Tralokinumab%20sold%20under%20the%20brand,targets%20the%20cytokine%20interleukin%2013.
17. CAS 1044515-88-9: Tralokinumab - CymitQuimica, accessed September 1, 2025, https://cymitquimica.com/cas/1044515-88-9/
18. Tralokinumab (CAT354) | IL-13 Inhibitor - MedchemExpress.com, accessed September 1, 2025, https://www.medchemexpress.com/tralokinumab.html
19. Tralokinumab - BioCat, accessed September 1, 2025, https://www.biocat.com/products/tralokinumab-t76704-1mg-tm
20. Tralokinumab - Drugs and Lactation Database (LactMed®) - NCBI Bookshelf, accessed September 1, 2025, https://www.ncbi.nlm.nih.gov/books/NBK576870/
21. KEGG DRUG: Tralokinumab, accessed September 1, 2025, https://www.genome.jp/dbget-bin/www_bget?dr:D09979
22. Tralokinumab: Uses, Benefits, and Considerations - DermNet, accessed September 1, 2025, https://dermnetnz.org/topics/tralokinumab
23. Tralokinumab Completed Phase 2 Trials for Atopic Dermatitis Treatment | DrugBank Online, accessed September 1, 2025, https://go.drugbank.com/drugs/DB12169/clinical_trials?conditions=DBCOND0028414&phase=2&purpose=treatment&status=completed
24. Mechanism of action of dupilumab, lebrikizumab, and tralokinumab. (a)... - ResearchGate, accessed September 1, 2025, https://www.researchgate.net/figure/Mechanism-of-action-of-dupilumab-lebrikizumab-and-tralokinumab-a-Dupilumab-acts_fig1_347857728
25. (PDF) Biomarkers in Atopic Dermatitis: A Review of the Role of IL-13 and the Impact of Tralokinumab Treatment - ResearchGate, accessed September 1, 2025, https://www.researchgate.net/publication/388073782_Biomarkers_in_Atopic_Dermatitis_A_Review_of_the_Role_of_IL-13_and_the_Impact_of_Tralokinumab_Treatment
26. Biomarkers in Atopic Dermatitis: A Review of the Role of IL-13 and the Impact of Tralokinumab Treatment - PMC, accessed September 1, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC11850464/
27. What is the mechanism of Tralokinumab? - Patsnap Synapse, accessed September 1, 2025, https://synapse.patsnap.com/article/what-is-the-mechanism-of-tralokinumab
28. Population Pharmacokinetics of Tralokinumab in Adult Subjects With Moderate to Severe Atopic Dermatitis - PMC - PubMed Central, accessed September 1, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC9796478/
29. Tralokinumab for moderate‐to‐severe atopic dermatitis: results from two 52‐week, randomized, double‐blind, multicentre, placebo‐controlled phase III trials (ECZTRA 1 and ECZTRA 2)* | British Journal of Dermatology | Oxford Academic, accessed September 1, 2025, https://academic.oup.com/bjd/article/184/3/437/6702212
30. AstraZeneca provides update on tralokinumab Phase III programme in severe, uncontrolled asthma, accessed September 1, 2025, https://www.astrazeneca.com/media-centre/press-releases/2017/astrazeneca-provides-update-on-tralokinumab-phase-iii-programme-in-severe-uncontrolled-asthma-01112017.html
31. Tralokinumab Effectively Disrupts the IL-13/IL-13Rα1/IL-4Rα Signaling Complex but Not the IL-13/IL-13Rα2 Complex, accessed September 1, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC10405097/
32. Tralokinumab Completed Phase 1 Trials for Asthma Treatment | DrugBank Online, accessed September 1, 2025, https://go.drugbank.com/drugs/DB12169/clinical_trials?conditions=DBCOND0013565&phase=1&purpose=treatment&status=completed
33. LEO Pharma announces European Commission approval of Adtralza® (tralokinumab) as the first and only treatment specifically targeting IL-13 for adults with moderate-to-severe atopic dermatitis, accessed September 1, 2025, https://www.leo-pharma.us/media-center/news/leo-pharma-announces-european-commission-approval-of-adtralza
34. Tralokinumab Normalizes Expression of Inflammatory Biomarkers in Atopic Dermatitis, accessed September 1, 2025, https://community.the-hospitalist.org/content/tralokinumab-normalizes-expression-inflammatory-biomarkers-atopic-dermatitis
35. Targeting IL-13 with tralokinumab normalizes type 2 inflammation in atopic dermatitis both early and at 2 years - Mount Sinai Scholars Portal, accessed September 1, 2025, https://scholars.mssm.edu/en/publications/targeting-il-13-with-tralokinumab-normalizes-type-2-inflammation-
36. Tralokinumab-ldrm (subcutaneous route) - Side effects & dosage - Mayo Clinic, accessed September 1, 2025, https://www.mayoclinic.org/drugs-supplements/tralokinumab-ldrm-subcutaneous-route/description/drg-20528296
37. 761180Orig1s000 - accessdata.fda.gov, accessed September 1, 2025, https://www.accessdata.fda.gov/drugsatfda_docs/nda/2022/761180Orig1s000OtherR.pdf
38. BLA 761180-S001 Multi-disciplinary Review and Evaluation ADBRY (tralokinumab) - FDA, accessed September 1, 2025, https://www.fda.gov/media/180788/download
39. Adtralza | European Medicines Agency (EMA), accessed September 1, 2025, https://www.ema.europa.eu/en/medicines/human/EPAR/adtralza
40. Tralokinumab granted first approval in the European Union - The Antibody Society, accessed September 1, 2025, https://www.antibodysociety.org/antibody-therapeutic/tralokinumab-granted-first-approval-in-the-european-union/
41. Tralokinumab for the Treatment of Adult Atopic Dermatitis in Special Populations - PubMed, accessed September 1, 2025, https://pubmed.ncbi.nlm.nih.gov/39161703/
42. tralokinumab | Ligand page - IUPHAR/BPS Guide to PHARMACOLOGY, accessed September 1, 2025, https://www.guidetopharmacology.org/GRAC/LigandDisplayForward?tab=clinical&ligandId=8001
43. A phase II placebo-controlled study of tralokinumab in moderate-to-severe asthma - PMC, accessed September 1, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC3561510/
44. Tralokinumab did not demonstrate oral corticosteroid-sparing effects in severe asthma, accessed September 1, 2025, https://publications.ersnet.org/content/erj/53/2/1800948
45. A phase II placebo-controlled study of tralokinumab in moderate-to-severe asthma, accessed September 1, 2025, https://publications.ersnet.org/content/erj/41/2/330
46. AstraZeneca asthma drug fails in phase III trial - The Pharmaceutical Journal, accessed September 1, 2025, https://pharmaceutical-journal.com/article/news/astrazeneca-asthma-drug-fails-in-phase-iii-trial
47. Tralokinumab did not demonstrate oral corticosteroid-sparing effects in severe asthma, accessed September 1, 2025, https://pubmed.ncbi.nlm.nih.gov/30442714/
48. Tralokinumab - LEO Pharma - AdisInsight - Springer, accessed September 1, 2025, https://adisinsight.springer.com/drugs/800019573
49. Tralokinumab Completed Phase 2 Trials for Alopecia Areata (AA) Treatment - DrugBank, accessed September 1, 2025, https://go.drugbank.com/drugs/DB12169/clinical_trials?conditions=DBCOND0071530&phase=2&purpose=treatment&status=completed
50. This medicinal product is subject to additional monitoring. This will allow quick identification of - Adtralza, INN-tralokinumab, accessed September 1, 2025, https://ec.europa.eu/health/documents/community-register/2021/20210617151835/anx_151835_en.pdf
51. Tralokinumab: Uses, Dosage, Side Effects & Warnings - Drugs.com, accessed September 1, 2025, https://www.drugs.com/tralokinumab.html
52. Adbry® Side Effects & Safety | What to Know Before Starting, accessed September 1, 2025, https://www.adbry.com/about-adbry/adbry-side-effects
53. Tralokinumab-ldrm: uses, dosing, warnings, adverse events, interactions - MedCentral, accessed September 1, 2025, https://www.medcentral.com/drugs/monograph/183293-322008/tralokinumab-ldrm-subcutaneous
54. Tralokinumab (Adtralza®) RMP Summary - Swissmedic, accessed September 1, 2025, https://www.swissmedic.ch/dam/swissmedic/en/dokumente/marktueberwachung/rmp/tralokinumab_adtralza-rmp-summary.pdf.download.pdf/Tralokinumab_Adtralza_RMP%20Summary%20-%20Version%201.0.pdf
55. Tralokinumab: Side Effects, Uses, Dosage, Interactions, Warnings - RxList, accessed September 1, 2025, https://www.rxlist.com/tralokinumab/generic-drug.htm
56. Adbry® (tralokinumab-ldrm) for moderate-to-severe Eczema, accessed September 1, 2025, https://www.adbry.com/
57. HIGHLIGHTS OF PRESCRIBING INFORMATION - accessdata.fda.gov, accessed September 1, 2025, https://www.accessdata.fda.gov/drugsatfda_docs/label/2023/761180s001lbl.pdf
58. Tralokinumab-ldrm (ADBRY) in Atopic Dermatitis Criteria for Use August 2024 | VA.gov, accessed September 1, 2025, https://www.va.gov/formularyadvisor/DOC_PDF/CFU_Tralokinumab-ldrm_ADBRY_in_Atopic_Dermatitis_Criteria_for_Use_Rev_Aug_2024.pdf
59. ADBRY™ (tralokinumab), accessed September 1, 2025, https://fm.formularynavigator.com/FormularyNavigator/DocumentManager/Download?clientDocumentId=Wa-WMWBa0U6ZphbxwhotNg
60. Adbry (tralokinumab-ldrm) injection - accessdata.fda.gov, accessed September 1, 2025, https://www.accessdata.fda.gov/drugsatfda_docs/appletter/2024/761180Orig1s006ltr.pdf
61. Tralokinumab-ldrm injection: MedlinePlus Drug Information, accessed September 1, 2025, https://medlineplus.gov/druginfo/meds/a622011.html
62. Adtralza (tralokinumab) - News, Articles etc. - European Pharmaceutical Review, accessed September 1, 2025, https://www.europeanpharmaceuticalreview.com/drug/adtralza-tralokinumab/
63. PRODUCT MONOGRAPH INCLUDING PATIENT MEDICATION INFORMATION - E-lactancia, accessed September 1, 2025, https://www.e-lactancia.org/media/papers/Tralokinumab-DS-LEO2021.pdf
64. SPECIALTY GUIDELINE MANAGEMENT Adbry (tralokinumab-ldrm) POLICY I. INDICATIONS The indications below including FDA-approved indi, accessed September 1, 2025, https://www.nhpri.org/wp-content/uploads/2023/06/Medicaid_Adbry_20230622.pdf
65. Clinical Review - Tralokinumab (Adtralza) - NCBI Bookshelf, accessed September 1, 2025, https://www.ncbi.nlm.nih.gov/books/NBK603641/