Corynebacterium diphtheriae Toxoid Antigen (DB10584): A Comprehensive Monograph on its Biochemistry, Clinical Application, and Public Health Significance

Executive Summary & Introduction

Overview of Diphtheria

Diphtheria is an acute, toxin-mediated infectious disease caused by toxigenic strains of the bacterium Corynebacterium diphtheriae.[1] The disease classically manifests in the upper respiratory tract, particularly the nasopharynx, or on the skin.[1] Its hallmark clinical sign is the formation of a dense, gray, adherent pseudomembrane composed of fibrin, bacteria, and inflammatory cells, which covers the pharynx and tonsils.[1] This pseudomembrane can cause severe breathing difficulties and, in advanced cases, lead to airway obstruction and death by suffocation.[4]

The primary virulence factor and the cause of systemic disease is a potent exotoxin secreted by the bacterium.[1] Once absorbed into the circulatory system, the diphtheria toxin is distributed to distant organs, where it can elicit severe and life-threatening complications, including myocarditis (inflammation of the heart muscle) leading to congestive heart failure, and peripheral neuropathy causing paralysis.[1] With a fatality rate of 5-10%, which can be even higher in young children, diphtheria remains a serious global health threat, particularly in regions with inadequate immunization coverage.[7]

The Diphtheria Toxoid: A Cornerstone of Modern Vaccinology

The control and near-elimination of diphtheria in many parts of the world represents one of the greatest triumphs of modern vaccinology. This success is owed almost entirely to the development of the diphtheria toxoid, identified in DrugBank as Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) (DB10584).[9] This antigen is a toxoid—a bacterial toxin that has been rendered non-toxic through chemical treatment but retains its immunogenicity.[1] The process involves the careful inactivation of the purified diphtheria toxin with formaldehyde, which abolishes its pathogenic activity while preserving the key protein structures (epitopes) that the immune system recognizes.[3] Administration of the toxoid induces a robust, protective antibody response, providing active immunity against the disease without ever exposing the recipient to the dangers of the active toxin.[1]

Scope of the Monograph

This monograph provides an exhaustive scientific and clinical analysis of the Corynebacterium diphtheriae toxoid antigen (DB10584). It will detail the molecular biology of the source organism and its toxin, the biochemical principles of toxoid conversion, and the intricacies of its manufacturing and formulation. As this antigen is almost exclusively used in combination vaccines, this report will extensively analyze its role within these multi-component products, such as DTaP, Tdap, and hexavalent vaccines.[9] The document will further explore its immunological mechanism of action, clinical development pathway, established dosing regimens, comprehensive safety profile, and its transformative impact on global public health.[7] Finally, this report will examine novel investigational applications, including its promising repurposing as an immunotherapeutic agent in the treatment of cancer, highlighting the enduring and evolving relevance of this century-old antigen.[17]

Molecular Profile and Biochemical Characteristics

Source Organism: Corynebacterium diphtheriae

The source of the diphtheria toxin is Corynebacterium diphtheriae, a Gram-positive, non-motile, non-encapsulated, and characteristically club-shaped bacillus.[1] It is also known as the Klebs-Löffler bacillus, named after its discoverers.[2] The species is further classified into different biotypes based on colony morphology and biochemical properties (e.g.,

mitis, intermedius, and gravis) and into lysotypes based on susceptibility to specific bacteriophages.[1]

Crucially, not all strains of C. diphtheriae are pathogenic. The ability to cause diphtheria is contingent on the production of the diphtheria toxin, a trait that is not inherent to the bacterium itself. The structural gene for the toxin, tox, is carried by a specific family of bacteriophages (viruses that infect bacteria), such as the well-studied β-phage.[1] Therefore, only strains that have been infected by and are lysogenic for one of these phages can produce the toxin and cause disease.[1] This phenomenon of lysogenic conversion, where a bacteriophage introduces new genetic material that alters the host bacterium's phenotype, means that a previously harmless strain of

C. diphtheriae can become virulent upon infection with the correct phage.[1] This dynamic interplay between the bacterial and viral genomes is a fundamental aspect of diphtheria's pathogenesis and has significant epidemiological implications. It suggests that eliminating the disease requires neutralizing the toxin's effects through widespread vaccination, as the bacterial reservoir for potential conversion to toxigenicity persists.

Toxin production is also tightly regulated by the bacterium's own genetic machinery. Expression of the phage-borne tox gene is controlled by the Diphtheria Toxin Repressor (DtxR), a protein encoded on the C. diphtheriae chromosome.[1] DtxR is activated by iron; in high-iron environments, the iron-DtxR complex binds to the

tox gene operator and represses transcription, shutting down toxin production. Conversely, under the low-iron conditions found in host tissues, the repressor is inactive, leading to high levels of toxin expression.[1] This regulatory mechanism is a critical consideration in the industrial manufacturing of the toxin for vaccine production, where culture media must be deferrated to ensure optimal yield.[1]

Structure and Function of the Native Diphtheria Toxin

The native diphtheria toxin is an extraordinarily potent A-B exotoxin. In sensitive species like humans, a dose as low as 100-150 nanograms per kilogram of body weight is lethal.[1] It is secreted as a single polypeptide proenzyme composed of 535 amino acids with a molecular weight of approximately 58 kDa.[1] The primary amino acid sequence is as follows [19]:

MLVRGYVVSRKLFASILIGALLGIGAPPSAHAGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKG IQPKKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAET IKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFE TRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESP NKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEKTT AALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYNFVESIINLF QVVHNSYNRpayspghktqpflhdgyavswntvedsiirtgfqgesghdikitentplpiagvllpti pgkldvnkskthisvngrkirMRCRAIDGDTFCRPKSPVYVGNGVHANLHVAFHRSSSEKIHSNEIS SDSIGVLGYQKTV

For its toxic activity, the proenzyme must undergo proteolytic cleavage, or "nicking," which separates it into two distinct fragments that remain linked by a single disulfide bridge.[3]

• Fragment A (Catalytic Domain): This N-terminal fragment, with a molecular weight of 21.2 kDa, is the enzymatically active component responsible for the toxin's cytotoxicity.[4] Once inside a host cell's cytosol, Fragment A functions as an NAD+-dependent ADP-ribosyltransferase. Its sole known substrate is Elongation Factor 2 (EF-2), a critical component of the protein synthesis machinery in eukaryotes.[1] By covalently attaching an ADP-ribose group from NAD+ to EF-2, Fragment A irreversibly inactivates it, thereby halting polypeptide chain elongation and shutting down all protein synthesis. This leads to rapid cell death, and the potency is so extreme that a single molecule of Fragment A is sufficient to kill a cell.[1]
• Fragment B (Binding and Translocation Domain): This C-terminal fragment, with a molecular weight of 37.1 kDa, is non-toxic but essential for pathogenesis.[4] It is composed of two subdomains: a receptor-binding domain and a transmembrane domain.[1] The receptor-binding domain specifically recognizes and attaches to the heparin-binding EGF-like growth factor (HB-EGF) precursor on the surface of susceptible host cells.[3] This binding triggers receptor-mediated endocytosis of the entire toxin molecule. Once inside an endosome, the acidic environment induces a conformational change in the transmembrane domain of Fragment B, allowing it to insert into the endosomal membrane and facilitate the translocation of Fragment A into the cytosol, where it can exert its lethal enzymatic activity.[1]

Conversion to Toxoid: The Principle of Detoxification

The production of a safe and effective diphtheria vaccine hinges on the conversion of the deadly toxin into a harmless but immunogenic toxoid. This is achieved through a carefully controlled process of chemical inactivation, primarily using formaldehyde (formalin).[3]

During this process, purified diphtheria toxin is incubated with formaldehyde, often for several weeks at approximately 37°C under alkaline conditions.[4] The formaldehyde induces covalent cross-linking between amino acid residues on the toxin protein, forming a stable, harmless protein aggregate.[18] This chemical modification irreversibly alters the three-dimensional structure of the catalytic site on Fragment A, completely abolishing its enzymatic activity and thus its toxicity.[18]

The critical challenge in this manufacturing step is to achieve complete detoxification without compromising the immunogenicity of the molecule. The protective immune response to diphtheria is mediated by neutralizing antibodies that primarily target the B-fragment, blocking its ability to bind to host cell receptors.[20] Therefore, the inactivation process must be precisely calibrated to preserve the native conformation and critical epitopes of the B-fragment. Over-treatment with formaldehyde could denature these epitopes, leading to a vaccine that induces non-neutralizing antibodies and fails to confer protection. Under-treatment carries the risk of incomplete detoxification and potential reversion to toxicity. This delicate balance makes the toxoiding process a masterclass in biochemical engineering and underscores the paramount importance of stringent Good Manufacturing Practices (GMP). To ensure safety, the final toxoid product is subjected to rigorous quality control tests, including in vitro cytotoxicity assays using sensitive cell lines like Chinese Hamster Ovary (CHO) cells, to confirm the complete loss of toxic activity.[3] The resulting product,

Corynebacterium diphtheriae toxoid antigen (DB10584), is the active moiety that stimulates protective immunity.[19]

Manufacturing, Formulation, and Vaccine Products

Production and Purification Process

The manufacturing of diphtheria toxoid is a multi-step biopharmaceutical process that begins with the selection of a suitable bacterial strain and ends with a highly purified, detoxified antigen.

• Upstream Processing: The process starts with the large-scale fermentation of a highly toxigenic strain of C. diphtheriae, such as NCTC 10648, in a specialized liquid culture medium.[3] The medium, often a modified Mueller's formulation containing bovine extracts, is carefully composed and deferrated (iron-depleted) to maximize the secretion of diphtheria toxin into the culture supernatant.[1]
• Downstream Processing: Once the toxin concentration in the culture reaches its peak, the downstream purification process begins.

1. Cell Separation: The bacterial cells are separated from the toxin-containing liquid supernatant. Modern methods may employ hollow fiber filter membranes for this step, which is more efficient and prevents the clogging of subsequent filters by cell debris.[23]
2. Concentration and Purification: The raw toxin in the supernatant is then concentrated and purified. This is typically achieved through a series of biochemical techniques, including tangential flow ultrafiltration to reduce volume, ammonium sulfate fractionation (salting out) to precipitate the toxin and separate it from other proteins, and finally, column chromatography for high-resolution purification.[22]
3. Detoxification: The purified toxin is converted to toxoid via the formaldehyde inactivation process, as detailed previously. This is the most critical step for ensuring both safety and efficacy.[3]
4. Final Polishing: The resulting toxoid undergoes further purification to remove residual impurities and potential allergens, yielding the final bulk antigen.[23]

Formulation with Adjuvants and Excipients

The purified diphtheria toxoid antigen (DB10584) is rarely administered alone. To enhance its immunogenicity, it is formulated with an adjuvant. The most commonly used adjuvants for diphtheria toxoid-containing vaccines are aluminum salts, such as aluminum phosphate or aluminum hydroxide.[22] The toxoid is adsorbed onto the surface of these aluminum salts. The adjuvant serves two primary functions: it creates an "antigen depot" at the site of injection, allowing for a slow release of the antigen, and it stimulates a local inflammatory response that recruits and activates antigen-presenting cells, thereby amplifying the overall immune response to the toxoid.[24]

The final vaccine formulation also contains various excipients. These can include buffers like Tris or glycine to maintain a stable pH, salts such as sodium chloride for isotonicity, and stabilizers like polysorbate 80.[3] The final product may also contain trace residual amounts of substances from the manufacturing process, such as formaldehyde, glutaraldehyde, or thimerosal (not as a preservative).[22]

Diphtheria Toxoid-Containing Vaccines: A Comparative Analysis

Diphtheria toxoid is a cornerstone of global childhood and adult immunization programs, but it is almost never given as a standalone vaccine. Instead, it is a key component of combination vaccines, which offer protection against multiple diseases in a single injection, thereby simplifying immunization schedules, reducing the number of required shots, and improving vaccination compliance.[4]

The various available formulations can be confusing, but they are primarily distinguished by two factors: the amount of diphtheria toxoid antigen they contain and the target age group for which they are licensed. The evolution from early DTP (diphtheria-tetanus-whole cell pertussis) vaccines to modern DTaP (acellular pertussis) formulations, and the subsequent development of reduced-antigen boosters (Tdap and Td), represents a sophisticated, multi-decade effort to optimize the benefit-risk profile of vaccination. The original DTP vaccines, while effective, were associated with higher rates of adverse reactions, largely attributed to the whole-cell pertussis component.[29] The switch to the less reactogenic acellular pertussis (aP) component in DTaP vaccines was a major step forward in safety.[29] Furthermore, clinical experience showed that administering the full pediatric dose of diphtheria toxoid to adolescents and adults, who typically have some pre-existing immunity, could lead to severe local hypersensitivity (Arthus-type) reactions due to high levels of circulating antibodies.[13] This immunological understanding directly drove the development of the Tdap and Td booster vaccines, which contain a significantly reduced amount of the diphtheria toxoid (indicated by the lowercase "d"). This lower dose is sufficient to boost waning immunity without provoking the severe reactogenicity associated with the full-strength pediatric formulation.[13] This tailored approach, modifying antigen content based on the recipient's age and likely immune status, is a hallmark of modern vaccinology.

The following table provides a comparative analysis of the main categories of vaccines containing diphtheria toxoid.

Vaccine Type	Acronym Meaning	Diphtheria Toxoid Content	Target Population	Primary Use	Common U.S. Brand Names
DTaP	Diphtheria, Tetanus, acellular Pertussis	Full-strength (uppercase 'D')	Infants & Children <7 years	Primary immunization series (5 doses)	Daptacel®, Infanrix®, Pediarix®, Pentacel®, Quadracel®, Vaxelis™ 9
Tdap	Tetanus, diphtheria, acellular pertussis	Reduced-strength (lowercase 'd')	Adolescents & Adults (≥7 years)	Adolescent booster, adult 10-year boosters, pregnancy	Adacel®, Boostrix® 9
Td	Tetanus, diphtheria	Reduced-strength (lowercase 'd')	Adolescents & Adults (≥7 years)	10-year boosters (alternative to Tdap), wound management	Tenivac®, TDVAX™ 9
DT	Diphtheria, Tetanus	Full-strength (uppercase 'D')	Infants & Children <7 years	For children with a contraindication to the pertussis component	No specific brand names are commonly cited; used in specific clinical situations 38

Immunological Mechanism of Action

Principle of Active Immunization

Vaccines containing diphtheria toxoid work by inducing active immunity.[40] The vaccine introduces the harmless, formaldehyde-inactivated toxoid into the body, which the immune system recognizes as a foreign antigen.[13] This exposure triggers a primary immune response, leading to the development of specific antibodies and immunological memory, all without causing the actual disease.[29]

Induction of Humoral Immunity

Upon intramuscular injection, the aluminum-adsorbed toxoid is taken up by local antigen-presenting cells (APCs), such as dendritic cells and macrophages. These cells process the toxoid protein and present its peptide fragments on their surface via MHC class II molecules. These APCs then migrate to nearby lymph nodes, where they present the antigen to naive CD4+ T-helper cells.

Activation of T-helper cells is a critical step that, in turn, provides help to B-lymphocytes that have also recognized the toxoid. This T-cell dependent B-cell activation stimulates the B-cells to undergo proliferation and differentiation into two key cell types: antibody-secreting plasma cells and long-lived memory B-cells. The plasma cells produce large quantities of high-affinity IgG antibodies specifically directed against the diphtheria toxin.[18]

The primary mechanism of protection is antibody-mediated neutralization. The protective antibodies generated by vaccination predominantly target the receptor-binding domain on the toxin's B-fragment.[20] By binding to this domain, the antibodies physically block the toxin from attaching to its cellular receptor, the HB-EGF precursor, on the surface of host cells.[3] This neutralization step is crucial, as it prevents the toxin's entry into the cell, thereby completely averting its cytotoxic effects.

Establishment of Immunological Memory

In addition to producing antibodies, the primary vaccination series establishes a robust pool of memory B-cells and memory T-cells. These cells persist for years and provide long-term protection. If a vaccinated individual is later exposed to the diphtheria toxin during a natural infection, or receives a booster dose of the vaccine, these memory cells are rapidly reactivated. This triggers a secondary immune response that is much faster, stronger, and more prolonged than the primary response, leading to a swift increase in serum antitoxin levels to concentrations that can effectively neutralize the threat before it can cause disease.

Correlates of Protection

Unlike for many other diseases, there is a well-established and quantifiable correlate of protection for diphtheria. Protective immunity is directly related to the concentration of circulating diphtheria antitoxin antibodies in the serum.[20] These antibody levels can be measured using laboratory tests such as an enzyme-linked immunosorbent assay (ELISA).[6]

Based on extensive observational data and clinical studies, the following thresholds have been defined by organizations like the World Health Organization (WHO) [40]:

• ≥0.1 IU/mL: This level of antitoxin is considered to provide full, reliable protection against diphtheria.
• 0.01 to <0.1 IU/mL: This range is considered to confer a basic or minimal level of protection. Individuals in this range are generally protected from severe disease, but a booster dose is often recommended to ensure more robust immunity.[6]
• <0.01 IU/mL: This level indicates susceptibility to diphtheria disease.[40]

It is important to recognize that vaccination with diphtheria toxoid induces anti-toxic immunity, not anti-bacterial immunity. The antibodies generated are highly effective at neutralizing the toxin, which is the agent of disease, but they do not target the surface components of the C. diphtheriae bacterium itself.[2] Consequently, vaccination prevents the clinical manifestations of diphtheria but does not necessarily prevent an individual from becoming colonized with toxigenic bacteria in their nasopharynx.[1] A fully vaccinated person can therefore become an asymptomatic carrier, protected from illness but still capable of transmitting the pathogenic bacteria to others who are unvaccinated or under-vaccinated. This fact has profound public health implications, as it demonstrates that eliminating the circulation of the dangerous bacterium requires achieving and maintaining very high levels of vaccination coverage (herd immunity) across the entire population to protect vulnerable individuals who cannot be vaccinated or do not mount a sufficient immune response.

Clinical Efficacy and Applications in Prophylaxis

Prevention of Diphtheria, Tetanus, and Pertussis

The primary and overwhelmingly successful indication for Corynebacterium diphtheriae toxoid antigen (DB10584) is the active immunization for the prevention of diphtheria.[43] As established, this antigen is invariably formulated in combination vaccines that also provide protection against tetanus and, in most cases, acellular pertussis.[15] The widespread implementation of routine childhood immunization programs with these combination vaccines has been a public health triumph, leading to a dramatic reduction in the incidence of diphtheria to the point of near-elimination in many developed nations.[11]

Analysis of Combination and Hexavalent Vaccines

The clinical development of diphtheria toxoid has been intrinsically linked to the evolution of combination vaccines. Numerous clinical trials, from Phase 3 pivotal studies to Phase 4 post-marketing surveillance, have rigorously evaluated the safety, immunogenicity, and efficacy of DB10584 as a component of these complex products.[15] These include not only the common DTaP and Tdap vaccines but also more complex pentavalent and hexavalent formulations. Hexavalent vaccines, such as Vaxelis™ and Hexyon™, combine protection against diphtheria, tetanus, and pertussis with antigens for poliomyelitis (IPV), hepatitis B (HepB), and

Haemophilus influenzae type b (Hib) into a single injection.[14] These multi-antigen vaccines are a cornerstone of modern pediatric medicine, as they significantly simplify the complex immunization schedule for infants, reducing the number of injections and associated distress, which in turn enhances parental adherence and overall vaccination coverage rates.[14] Post-marketing studies, such as the Phase 4 trial NCT05289271 evaluating Vaxelis™, continue to monitor the safety and immunogenicity of these vaccines in real-world populations, ensuring their continued favorable benefit-risk profile.[46]

The clinical trial landscape for diphtheria toxoid is mature, with a strong evidence base supporting its prophylactic use. However, it is not static. Recent and ongoing studies reveal an evolving understanding and application of the vaccine. For instance, trial NCT03982732 is investigating the transfer of vaccine-induced antibodies into breastmilk following maternal Tdap vaccination.[48] This research explores the dynamics of passive immunity, aiming to optimize strategies for protecting newborns in the critical first months of life before they can begin their own primary immunization series. This focus on maternal-infant immunity represents a more nuanced application of the vaccine. Simultaneously, the toxoid is being explored in entirely new therapeutic areas, as demonstrated by the glioblastoma trial discussed later, indicating a dynamic future for this well-established antigen.

The following table summarizes key clinical trials that illustrate the breadth of clinical investigation involving vaccines containing diphtheria toxoid (DB10584).

Trial ID	Phase	Indication(s)	Purpose	Vaccine(s) / Drugs Studied	Key Finding / Relevance
NCT05289271	4	Hexavalent Vaccine	Prevention	Vaxelis™/Hexyon™ (contains DB10584)	Post-marketing assessment of the safety and immunogenicity of a hexavalent vaccine in children.46
Multiple	4	Diphtheria, Tetanus, Acellular Pertussis	Prevention	DTaP vaccines (contain DB10584)	Confirms long-term prophylactic efficacy and safety in real-world use after market approval.43
Multiple	3	Diphtheria, Tetanus, Acellular Pertussis (+/- Polio, Hib)	Prevention	Various DTaP-based combination vaccines	Pivotal trials establishing the immunogenicity and safety required for the licensure of multi-antigen pediatric vaccines.15
NCT02465268	2	Glioblastoma Multiforme (GBM), Malignant Glioma	Treatment	Corynebacterium diphtheriae toxoid antigen (DB10584)	Investigational use as an immunotherapeutic agent to treat a form of brain cancer, a radical departure from its prophylactic role.17
NCT03982732	N/A	Maternal Antibody Transfer	Prevention	Tdap vaccine (contains DB10584)	Investigates the transfer of vaccine-induced antibodies into breastmilk to confer passive immunity to infants.48

Dosing Regimens and Administration

Administration

All currently available diphtheria toxoid-containing vaccines are intended for intramuscular (IM) injection only.[49] The specific site of administration is age-dependent to ensure delivery into a sufficiently large muscle mass and to minimize local reactions. For infants and young children, the preferred injection site is the anterolateral aspect of the thigh (vastus lateralis muscle). For older children, adolescents, and adults, the preferred site is the deltoid muscle of the upper arm.[49]

Pediatric Immunization (Birth to 6 years)

The U.S. Centers for Disease Control and Prevention (CDC) recommends a routine 5-dose primary and booster series using a DTaP-containing vaccine for all children younger than 7 years of age.[50] The standard schedule is as follows [49]:

• Dose 1: 2 months of age
• Dose 2: 4 months of age
• Dose 3: 6 months of age
• Dose 4 (Booster): 15 through 18 months of age
• Dose 5 (Booster): 4 through 6 years of age (typically before school entry)

Adolescent and Adult Immunization

As immunity wanes over time, booster doses are required to maintain protection throughout life.

• Adolescents: A single booster dose of the reduced-antigen Tdap vaccine is recommended for all adolescents, preferably at 11 to 12 years of age.[50]
• Adults: Following the adolescent Tdap dose, adults should receive a booster dose of either Tdap or the Td vaccine every 10 years.[29] For adults who were never vaccinated or whose vaccination history is incomplete, a primary series should be initiated or completed. The CDC recommends that the first dose of this series should be Tdap.[53]

Special Populations and Considerations

• Pregnancy: To protect newborns from pertussis before they are old enough to be vaccinated, the CDC strongly recommends that pregnant women receive one dose of Tdap during each pregnancy. The optimal timing is during the third trimester, between 27 and 36 weeks of gestation, to maximize the transfer of maternal antibodies across the placenta to the fetus.[35]
• Wound Management: In cases of clean or contaminated wounds, an individual's vaccination history determines the need for a tetanus-toxoid containing vaccine (Tdap or Td) to prevent tetanus.[13]
• Catch-Up Schedules: The CDC provides detailed catch-up immunization schedules for children, adolescents, and adults who have fallen behind or have never been vaccinated. These schedules specify the minimum intervals required between doses to ensure an effective immune response.[52]

The following table summarizes the routine immunization schedules for diphtheria toxoid-containing vaccines based on U.S. CDC guidelines.

Age Group	Recommended Vaccine	Schedule	Key Notes
Infants/Children (<7 yrs)	DTaP	Primary Series: 2, 4, 6 months. Boosters: 15-18 months, 4-6 years.	5 doses total. Dose 5 is not necessary if Dose 4 was administered on or after the 4th birthday.49
Adolescents (11-12 yrs)	Tdap	Single dose.	This serves as the routine adolescent booster dose to reinforce waning immunity.51
Adults (≥19 yrs)	Tdap or Td	Booster every 10 years.	Tdap should be administered at least once during adulthood, preferably as the first booster dose replacing Td.51
Pregnancy	Tdap	One dose per pregnancy, ideally at 27-36 weeks gestation.	This strategy primarily targets passive protection of the newborn against pertussis.50
Catch-Up (Unvaccinated Adult)	Tdap, then Td/Tdap	3-dose series: Dose 1 (Tdap), Dose 2 at ≥4 weeks, Dose 3 at 6-12 months after Dose 2.	There is no need to restart a series that has been interrupted; simply resume the schedule.53

Safety, Tolerability, and Contraindications

Diphtheria toxoid-containing vaccines are considered very safe, and the benefits of vaccination far outweigh the risks. However, like any medicine, they can cause side effects.

Common Adverse Events

The vast majority of adverse events are mild, self-limiting, and resolve within 1 to 3 days without intervention.[55]

• Local Reactions: The most frequently reported side effects occur at the injection site and include pain, redness, swelling, tenderness, or the formation of a hard lump.[38] These reactions are common, occurring in up to one in four children after a DTaP dose.[58]
• Systemic Reactions: Mild systemic reactions are also common and include low-grade fever, fussiness or irritability (especially in infants), fatigue, headache, and loss of appetite.[38]

Rare but Serious Adverse Events

Serious adverse events are very rare but require medical attention.

• Anaphylaxis: A severe, immediate, and life-threatening allergic reaction can occur after any vaccine but is estimated to happen in less than one per million doses.[26]
• Neurological Events: Seizures (often associated with fever), hypotonic-hyporesponsive episodes (HHE, or collapse/shock-like state), and persistent, inconsolable crying for three or more hours have been reported very rarely following DTaP vaccination.[58] A history of Guillain-Barré Syndrome (GBS), a rare disorder where the immune system attacks the nerves, within six weeks of a previous tetanus-toxoid vaccine is considered a precaution for future doses.[39]
• Arthus-Type Hypersensitivity: These are severe, exaggerated local reactions characterized by extensive pain, swelling, and induration that typically begin 2 to 8 hours after injection.[38] These reactions are a form of Type III hypersensitivity (immune complex-mediated) and are more likely to occur in individuals who have received multiple prior boosters and have very high pre-existing levels of circulating antitoxin antibodies.[20] The interaction between the injected antigen and the high concentration of antibodies leads to the formation of immune complexes that deposit in local blood vessel walls, triggering intense inflammation. This specific immunopathological mechanism is the primary reason that reduced-antigen Td and Tdap boosters were developed for adolescent and adult use, mitigating the risk of such reactions in populations with pre-existing immunity.
• Extensive Limb Swelling: Swelling of the entire arm or leg in which the shot was given can occur, particularly after the 4th or 5th dose of the DTaP series. While alarming, this reaction is transient and resolves without permanent damage.[58]

Contraindications

A contraindication is a condition in a recipient that greatly increases the chance of a serious adverse reaction.

• Absolute Contraindications:
• A history of a severe allergic reaction (i.e., anaphylaxis) to a previous dose of the vaccine or to any of its components is an absolute contraindication to further doses.[26]
• A history of encephalopathy (e.g., coma, decreased level of consciousness, prolonged seizures) that is not attributable to another identifiable cause and which occurred within 7 days of a previous dose of a pertussis-containing vaccine (DTaP or Tdap) is a contraindication to receiving further pertussis-containing vaccines.[39]

Precautions

A precaution is a condition that might increase the risk of a serious adverse reaction or that might compromise the ability of the vaccine to produce immunity. In these cases, the benefits of vaccination must be carefully weighed against the potential risks.

• Moderate or severe acute illness with or without fever (vaccination should generally be postponed until the illness has improved).[59]
• Progressive or unstable neurologic disorder, such as infantile spasms or uncontrolled epilepsy (vaccination with pertussis-containing vaccines should be deferred until the condition has been evaluated and stabilized).[39]
• History of Guillain-Barré Syndrome (GBS) within 6 weeks of receiving a prior vaccine containing tetanus toxoid.[39]
• History of an Arthus-type hypersensitivity reaction following a previous dose of a diphtheria or tetanus toxoid-containing vaccine (future tetanus and diphtheria toxoid-containing vaccines should be deferred for at least 10 years).[39]

Drug and Therapeutic Interactions

Immunosuppressive Therapies

The primary therapeutic interaction of concern for diphtheria toxoid-containing vaccines is with immunosuppressive drugs. The efficacy of the vaccine, which depends on a robust immune response, can be significantly diminished in individuals receiving therapies that suppress immune function.[9] This includes:

• Systemic corticosteroids
• Chemotherapy agents such as altretamine and amsacrine.[9]
• Biologic agents used to treat autoimmune disorders or prevent organ transplant rejection, such as alefacept, alemtuzumab, adalimumab, and infliximab.[9]

These medications function by depleting or inhibiting the activity of lymphocytes (T-cells and B-cells), which are the essential mediators of the adaptive immune response required to generate protective antibodies and immunological memory against the toxoid. The list of interacting drugs thus serves as a functional map of the vaccine's mechanism of action, confirming that a healthy T-cell and B-cell response is paramount for successful vaccination. This has important clinical implications for the timing of vaccination in patients who are about to begin or are currently undergoing immunosuppressive treatment.

Co-administration with Other Vaccines

Diphtheria toxoid-containing vaccines are designed for and have been extensively studied in co-administration with other routine vaccines. Clinical trials have consistently shown that the simultaneous administration of vaccines like DTaP with others such as Measles-Mumps-Rubella (MMR), Inactivated Poliovirus Vaccine (IPV), Hepatitis B (HepB), or Haemophilus influenzae type b (Hib) does not result in clinically significant interference with the immune response to any of the antigens, nor does it increase the rate or severity of adverse events compared to when the vaccines are administered separately.[38] This compatibility is a key feature that enables the implementation of comprehensive and efficient immunization schedules.

Investigational and Emerging Applications

A Paradigm Shift: Diphtheria Toxoid in Oncologic Immunotherapy

While the prophylactic role of diphtheria toxoid is well-established, the most significant and paradigm-shifting emerging application is its investigation as a therapeutic agent for cancer. A completed Phase 2 clinical trial (NCT02465268) evaluated the use of diphtheria and tetanus toxoids for the treatment of newly diagnosed glioblastoma multiforme (GBM), an aggressive and difficult-to-treat brain tumor.[17] This represents a complete repurposing of the antigen, moving it from the prevention of an infectious disease to the direct immunotherapy of a non-infectious, solid tumor.

Proposed Mechanism in Glioblastoma

The therapeutic strategy in the GBM trial does not rely on any direct oncolytic (cancer-killing) property of the toxoid. Instead, it leverages the patient's pre-existing, vaccine-induced immunity to turn a "cold" tumor "hot." Glioblastoma is notoriously immunologically "cold," meaning it has a highly immunosuppressive tumor microenvironment that actively excludes cancer-fighting T-cells, rendering it resistant to many forms of immunotherapy.

The investigational approach involves injecting the diphtheria toxoid directly into the tumor post-resection. Because virtually the entire patient population has been vaccinated against diphtheria and possesses strong immunological memory to the toxoid, this injection is designed to trigger a powerful recall immune response precisely at the tumor site.[7] This elicits a massive influx of inflammatory cells and cytokines, disrupting the local immunosuppressive environment. This concept, known as creating an

in situ vaccine, uses the targeted immune response against the toxoid as an inflammatory catalyst. The resulting inflammation and cell death are hypothesized to release tumor-specific antigens in a pro-inflammatory context, which can then be picked up by newly recruited APCs. This can lead to "epitope spreading," where the initial immune response against the toxoid broadens to include a new, secondary immune response directed specifically against the patient's own tumor cells.

This is a brilliant immunologic strategy that hijacks one of the most reliable and potent immune responses in human history and redirects its power to fight cancer. It uses the diphtheria toxoid as a "universal recall antigen" to overcome one of the central challenges in modern cancer immunotherapy: breaking immune tolerance in non-immunogenic tumors. This approach represents a potential platform technology, where other common recall antigens (like tetanus toxoid, which was also used in the trial) could be employed similarly to convert immunologically silent tumors into sites of active immune engagement.

Regulatory History and Global Public Health Impact

Historical Development and Licensure

The scientific journey of the diphtheria vaccine began in the 1920s. In 1923, French veterinarian Gaston Ramon at the Pasteur Institute discovered that treating diphtheria toxin with formaldehyde and heat resulted in a non-toxic but still immunogenic "toxoid".[10] Shortly thereafter, in 1926, Alexander Glenny in the UK found that adsorbing the toxoid onto an aluminum salt (alum) significantly enhanced the immune response.[10] These two discoveries laid the fundamental groundwork for all subsequent diphtheria vaccines.

In the United States, the first combined Diphtheria and Tetanus Toxoids and whole-cell Pertussis (DTP) vaccine was licensed in 1949.[30] This vaccine was the standard for decades until concerns about reactogenicity, primarily from the whole-cell pertussis component, drove the development of safer alternatives. In 1991, the first acellular pertussis combination vaccine (DTaP) was approved for use as a booster, and by 1997, the Advisory Committee on Immunization Practices (ACIP) recommended a full 5-dose DTaP series for all children, replacing DTP.[10]

The 21st century brought a focus on adolescent and adult immunity. In 2005, the FDA licensed the first Tdap vaccines—Adacel® (Sanofi Pasteur) and Boostrix® (GlaxoSmithKline)—for use as boosters in adolescents and adults.[30] These approvals have since been expanded to include older adults and, critically, for use during pregnancy to protect newborns.[36] This regulatory history illustrates a continuous cycle of innovation: from the initial discovery of the toxoid, to its combination with other antigens for efficiency, to safety refinements (DTP to DTaP), to the development of age-specific formulations (Tdap/Td), and finally to the expansion of its strategic use to new populations like pregnant women. The ongoing investigation into its use in oncology shows this cycle of innovation continues today.

Public Health Impact

The impact of the diphtheria vaccine on global public health has been nothing short of transformative. In the pre-vaccine era, diphtheria was a common and feared killer of children. In the 1920s, the United States recorded as many as 150,000 cases and 15,000 deaths from diphtheria in a single year.[13] Following the widespread introduction of the vaccine, the disease has been virtually eliminated in the U.S., with only one case reported to the CDC since 2004.[44]

Globally, the World Health Organization (WHO) and the Pan American Health Organization (PAHO) report that vaccination has dramatically reduced diphtheria-related morbidity and mortality.[7] However, the disease remains a significant public health problem in countries with poor routine immunization coverage, where it occurs in sporadic cases and small outbreaks.[7] The ongoing risk is substantial, as disruptions to routine vaccination services—such as those seen during the COVID-19 pandemic—can leave millions of children vulnerable and raise the risk of resurgence for diseases like diphtheria.[7]

Conclusion and Future Perspectives

Summary of a Public Health Triumph

Corynebacterium diphtheriae toxoid antigen (DB10584) stands as a monumental achievement in the history of medicine. As the active component in all modern diphtheria vaccines, this safe and highly effective immunogen has been the central tool in the global effort to control a once-devastating disease. Its development and deployment have saved countless lives and have driven the near-elimination of diphtheria in all countries with robust immunization programs.

A Multifaceted Immunological Tool

The story of the diphtheria toxoid is one of continuous evolution and refinement. From its initial discovery, it has been adapted into a multifaceted immunological tool. Its incorporation into combination vaccines has been critical for the success of pediatric immunization schedules worldwide. The development of distinct full-strength (DTaP) and reduced-strength (Tdap/Td) formulations demonstrates a sophisticated, evidence-based approach to tailoring vaccination to the immunological status of different age groups, maximizing protection while minimizing risk.

Future Directions

Despite its long history, the future of the diphtheria toxoid remains dynamic.

• Global Health: The primary and most urgent challenge is to close the global immunization gap. Renewed efforts and resources are needed to strengthen routine vaccination programs in underserved countries to prevent outbreaks and move towards global control of the disease. Research into more thermostable vaccine formulations could also help overcome logistical challenges in remote and low-resource settings.
• Vaccine Technology: The development of next-generation combination vaccines will likely continue, potentially incorporating additional antigens or utilizing novel adjuvant systems to further enhance the duration or quality of the immune response.
• Therapeutic Repurposing: The most exciting and innovative frontier for this antigen lies in its potential repurposing as an in situ cancer vaccine. The investigation of its use in glioblastoma has opened a new therapeutic paradigm. Future research should focus on fully elucidating the immunological mechanisms at play in this context and exploring the strategy's applicability to other immunologically "cold" tumors. This approach offers the tantalizing prospect of a novel, cost-effective immunotherapy built upon an antigen with an unparalleled track record of safety and immunogenicity, proving that even a century-old discovery can find new life at the cutting edge of science.

Works cited

1. Corynebacterium Diphtheriae - Medical Microbiology - NCBI Bookshelf, accessed July 22, 2025, https://www.ncbi.nlm.nih.gov/books/NBK7971/
2. Corynebacterium diphtheriae - Wikipedia, accessed July 22, 2025, https://en.wikipedia.org/wiki/Corynebacterium_diphtheriae
3. Diphtheria Toxoid (Frozen) - The Native Antigen Company, accessed July 22, 2025, https://thenativeantigencompany.com/products/diphtheria-toxoid-frozen/
4. Structural Characterisation of Diphtheria Toxoid - DSpace, accessed July 22, 2025, https://dspace.library.uu.nl/bitstream/handle/1874/1709/full.pdf?sequence=8
5. Diphtheria - Symptoms & causes - Mayo Clinic, accessed July 22, 2025, https://www.mayoclinic.org/diseases-conditions/diphtheria/symptoms-causes/syc-20351897
6. DIPGS - Overview: Diphtheria Toxoid IgG Antibody, Serum - Mayo Clinic Laboratories, accessed July 22, 2025, https://www.mayocliniclabs.com/test-catalog/overview/36664
7. Immunization, Vaccines and Biologicals: Diphtheria - World Health Organization (WHO), accessed July 22, 2025, https://www.who.int/teams/immunization-vaccines-and-biologicals/diseases/diphtheria
8. Diphtheria - PAHO/WHO | Pan American Health Organization, accessed July 22, 2025, https://www.paho.org/en/topics/diphtheria
9. Corynebacterium diphtheriae toxoid antigen (formaldehyde ..., accessed July 22, 2025, https://go.drugbank.com/drugs/DB10584
10. History of Diphtheria Vaccine - NVIC.org, accessed July 22, 2025, https://www.nvic.org/disease-vaccine/diphtheria/vaccine-history
11. Diphtheria | History of Vaccines, accessed July 22, 2025, https://historyofvaccines.org/history/diphtheria/overview/
12. Diphtheria Toxoid (Lyophilised) - The Native Antigen Company, accessed July 22, 2025, https://thenativeantigencompany.com/products/diphtheria-toxoid/
13. Diphtheria, Tetanus and Pertussis: The Diseases & Vaccines, accessed July 22, 2025, https://www.chop.edu/vaccine-education-center/vaccine-details/diphtheria-tetanus-and-pertussis-vaccines
14. DTaP-IPV-HepB vaccine - Wikipedia, accessed July 22, 2025, https://en.wikipedia.org/wiki/DTaP-IPV-HepB_vaccine
15. Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) Completed Phase 3 Trials for Diphtheria / Acellular Pertussis / Tetanus Prevention - DrugBank, accessed July 22, 2025, https://go.drugbank.com/drugs/DB10584/clinical_trials?conditions=DBCOND0031302%2CDBCOND0000394%2CDBCOND0000386&phase=3&purpose=prevention&status=completed
16. Types of Diphtheria Vaccines - CDC, accessed July 22, 2025, https://www.cdc.gov/diphtheria/vaccines/types.html
17. Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) Completed Phase 2 Trials for Astrocytoma, Grade IV / Glioblastoma Multiforme (GBM) / Malignant Glioma / Glioblastomas Treatment - DrugBank, accessed July 22, 2025, https://go.drugbank.com/drugs/DB10584/clinical_trials?conditions=DBCOND0044205%2CDBCOND0046976%2CDBCOND0043840%2CDBCOND0029627&phase=2&purpose=treatment&status=completed
18. C. diphtheriae Diphtheria Toxoid (DAG2689) - Creative Diagnostics, accessed July 22, 2025, https://www.creative-diagnostics.com/C-diphtheriae-Diphtheria-Toxoid-Antigen-105920-384.htm
19. CORYNEBACTERIUM DIPHTHERIAE TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED) - precisionFDA, accessed July 22, 2025, https://precision.fda.gov/ginas/app/ui/substances/aacc7cc7-7430-49a5-891e-b7f2f268d1c0
20. Diphtheria and Tetanus Toxoids - Adverse Events Associated with Childhood Vaccines - NCBI Bookshelf, accessed July 22, 2025, https://www.ncbi.nlm.nih.gov/books/NBK236292/
21. CORYNEBACTERIUM DIPHTHERIAE TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED) - Inxight Drugs, accessed July 22, 2025, https://drugs.ncats.io/drug/IRH51QN26H
22. Package Insert - TDVAX (NDC 14362-0111) - FDA, accessed July 22, 2025, https://www.fda.gov/media/76430/download
23. CN102961740B - Preparation method of diphtheria toxoid vaccine - Google Patents, accessed July 22, 2025, https://patents.google.com/patent/CN102961740B/en
24. MANUAL FOR THE PRODUCTION AND CONTROL OF VACCINES - World Health Organization (WHO), accessed July 22, 2025, https://apps.who.int/iris/bitstream/10665/70166/1/BLG_UNDP_77.2_Rev1_pg1-35.pdf
25. About Diphtheria, Tetanus, and Pertussis Vaccination | CDC, accessed July 22, 2025, https://www.cdc.gov/vaccines/vpd/dtap-tdap-td/hcp/about-vaccine.html
26. Diphtheria | The Australian Immunisation Handbook, accessed July 22, 2025, https://immunisationhandbook.health.gov.au/contents/vaccine-preventable-diseases/diphtheria
27. Diphtheria Toxoid - SERION antigens, accessed July 22, 2025, https://www.serion-immunologics.com/products/serion-antigens/diphtheria-toxoid/
28. DTaP-IPV-HepB vaccine - Wikiwand, accessed July 22, 2025, https://www.wikiwand.com/en/articles/DTaP-IPV-HepB_vaccine
29. DTaP vaccine | EBSCO Research Starters, accessed July 22, 2025, https://www.ebsco.com/research-starters/health-and-medicine/dtap-vaccine
30. DPT vaccine - Wikipedia, accessed July 22, 2025, https://en.wikipedia.org/wiki/DPT_vaccine
31. Ask the Experts: Diphtheria: Vaccine Products - Immunize.org, accessed July 22, 2025, https://www.immunize.org/ask-experts/topic/diphtheria/vaccine-products-diphtheria/
32. DTaP vs Tdap Vaccines - What's the difference between them? - Drugs.com, accessed July 22, 2025, https://www.drugs.com/medical-answers/difference-between-dtap-tdap-3508353/
33. Diphtheria, Tetanus, and Pertussis (DTaP) Vaccine - Women's Health, accessed July 22, 2025, https://www.afwomensmed.com/health-library/hw-view.php?DOCHWID=a682198
34. Diphtheria, Tetanus and Pertussis - Institute for Vaccine Safety, accessed July 22, 2025, https://www.vaccinesafety.edu/vaccine-preventable-diseases/
35. Tdap and DTaP | About Whooping Cough, accessed July 22, 2025, https://www.aboutwhoopingcough.com/tdap-vaccine/tdap-and-dtap/
36. Adacel (Tetanus Toxoid, Reduced Diphtheria Toxoid and Acellular Pertussis Vaccine Adsorbed (Tdap)) FDA Approval History - Drugs.com, accessed July 22, 2025, https://www.drugs.com/history/adacel.html
37. Boostrix (tetanus, diphtheria, acellular pertussis vaccine (Tdap)) FDA Approval History, accessed July 22, 2025, https://www.drugs.com/history/boostrix.html
38. Diphtheria and Tetanus (Diphtheria and Tetanus Toxoids): Side Effects, Uses, Dosage, Interactions, Warnings - RxList, accessed July 22, 2025, https://www.rxlist.com/diptheria-and-tetanus-drug.htm
39. Ask the Experts: Diphtheria: Contraindications & Precautions - Immunize.org, accessed July 22, 2025, https://www.immunize.org/ask-experts/topic/diphtheria/contraindications-precautions-diphtheria/
40. Diphtheria vaccine - World Health Organization (WHO), accessed July 22, 2025, https://terrance.who.int/mediacentre/data/sage/SAGE_Docs_Ppt_Apr2017/10_session_diptheria/Apr2017_session10_diphtheria_vax_effectiveness.pdf
41. www.ebsco.com, accessed July 22, 2025, https://www.ebsco.com/research-starters/health-and-medicine/dtap-vaccine#:~:text=to%20respiratory%20failure.-,Mechanism%20of%20Action,disease%2C%20protecting%20from%20future%20illness.
42. Diphtheria Tetanus Pertussis (DTaP) Vaccine - StatPearls - NCBI Bookshelf, accessed July 22, 2025, https://www.ncbi.nlm.nih.gov/books/NBK545173/
43. Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) Completed Phase 4 Trials for Diphtheria-Tetanus-acellular Pertussis Vaccines / Diphtheria / Acellular Pertussis / Tetanus Prevention - DrugBank, accessed July 22, 2025, https://go.drugbank.com/drugs/DB10584/clinical_trials?conditions=DBCOND0031302%2CDBCOND0000394%2CDBCOND0042901%2CDBCOND0000386&phase=4&purpose=prevention&status=completed
44. An overview of FDA-approved vaccines & their innovators - PMC, accessed July 22, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC6112117/
45. Corynebacterium diphtheriae toxoid antigen ... - DrugBank, accessed July 22, 2025, https://go.drugbank.com/drugs/DB10584/clinical_trials?conditions=DBCOND0000394%2CDBCOND0033285%2CDBCOND0014696%2CDBCOND0013769%2CDBCOND0000386&status=completed
46. Hexavalent Vaccine Completed Phase 4 Trials for Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) (DB10584) - DrugBank, accessed July 22, 2025, https://go.drugbank.com/indications/DBCOND0147035/clinical_trials/DB10584?phase=4&status=completed
47. DTaP-IPV-HepB vaccine - WikiProjectMed - MDWiki, accessed July 22, 2025, https://mdwiki.org/wiki/DTaP-IPV-HepB_vaccine
48. Breastmilk Unknown Status Phase Trials for Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) (DB10584) | DrugBank Online, accessed July 22, 2025, https://go.drugbank.com/indications/DBCOND0120640/clinical_trials/DB10584?status=unknown_status
49. Administering Diphtheria, Tetanus, and Pertussis Vaccines - CDC, accessed July 22, 2025, https://www.cdc.gov/vaccines/vpd/dtap-tdap-td/hcp/administering-vaccine.html
50. Diphtheria Vaccine Recommendations - CDC, accessed July 22, 2025, https://www.cdc.gov/diphtheria/vaccines/recommendations.html
51. Diphtheria Vaccine Recommendations - CDC, accessed July 22, 2025, https://www.cdc.gov/diphtheria/hcp/vaccine-recommendations/index.html
52. Child Immunization Schedule Notes | Vaccines & Immunizations - CDC, accessed July 22, 2025, https://www.cdc.gov/vaccines/hcp/imz-schedules/child-adolescent-notes.html
53. Standing orders for Administering Td/Tdap Vaccine to Adults - Immunize.org, accessed July 22, 2025, https://www.immunize.org/clinical/a-z/standing-orders-administering-td-tdap-vaccine-adults/
54. DTap, Tdap, and Td Catch-up Vaccination Recommendations by Prior Vaccine History and Age - Immunize.org, accessed July 22, 2025, https://www.immunize.org/clinical/a-z/dtap-tdap-td-catch-up-vaccination-recommendations-history-age/
55. Diphtheria, Tetanus, and Pertussis Vaccine Safety - CDC, accessed July 22, 2025, https://www.cdc.gov/vaccine-safety/vaccines/dtap-tdap.html
56. Side Effects of Diphtheria-Tetanus Toxoid in Adults - PMC, accessed July 22, 2025, https://pmc.ncbi.nlm.nih.gov/articles/PMC1619076/
57. Tetanus Shot Reactions: Side Effects of the Vaccine - Healthline, accessed July 22, 2025, https://www.healthline.com/health/vaccinations/tetanus-shot-side-effects
58. DIPHTHERIA TETANUS & PERTUSSIS VACCINES - Alabama Department of Public Health (ADPH), accessed July 22, 2025, https://www.alabamapublichealth.gov/immunization/assets/dtap.pdf
59. Tetanus-Diphtheria Vaccine - Infectious Diseases - MSD Manual Professional Edition, accessed July 22, 2025, https://www.msdmanuals.com/professional/infectious-diseases/immunization/tetanus-diphtheria-vaccine
60. Package Insert - DAPTACEL - FDA, accessed July 22, 2025, https://www.fda.gov/media/74035/download
61. Guide to Contraindications and Precautions to Commonly Used Vaccines - OEPS, accessed July 22, 2025, https://oeps.wv.gov/immunizations/documents/vfc/manual/8/contraindications_guide.pdf
62. Diphtheria Toxoid; Tetanus Toxoid Adsorbed, DT, Td - Cleveland Clinic, accessed July 22, 2025, https://my.clevelandclinic.org/health/drugs/19314-diphtheria-toxoid-tetanus-toxoid-adsorbed-dt-td
63. Diphtheria: A hundred years ago, the first toxoid vaccine | - Institut Pasteur, accessed July 22, 2025, https://www.pasteur.fr/en/research-journal/news/diphtheria-hundred-years-ago-first-toxoid-vaccine